Recombinant UPF0283 membrane protein YPO2347/y1985/YP_2134 (YPO2347, y1985, YP_2134)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YPO2347; y1985; YP_2134; UPF0283 membrane protein YPO2347/y1985/YP_2134
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Yersinia pestis
Target Names
YPO2347
Target Protein Sequence
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
Uniprot No.

Target Background

Database Links

KEGG: ype:YPO2347

STRING: 187410.y1985

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0283 membrane protein YPO2347/y1985/YP_2134?

UPF0283 membrane protein YPO2347/y1985/YP_2134 is a membrane protein derived from Yersinia pestis, the causative bacterium of plague. The "UPF" designation indicates it belongs to an uncharacterized protein family, meaning its precise biological function remains to be fully elucidated. This protein is identified by UniProt accession number Q8ZE38 and consists of 353 amino acids in its full-length form. Most commercially available preparations are expressed as recombinant proteins in E. coli systems for research purposes .

What is the optimal storage condition for recombinant UPF0283 membrane protein?

The optimal storage conditions for recombinant UPF0283 membrane protein depend on its formulation:

  • For liquid formulations: Store at -20°C/-80°C for up to 6 months

  • For lyophilized formulations: Store at -20°C/-80°C for up to 12 months

  • For working aliquots: Store at 4°C for up to one week

It is critical to note that repeated freezing and thawing is not recommended as it can compromise protein integrity and functional activity . When preparing the protein for long-term storage, incorporating glycerol to a final concentration of 5-50% (with 50% being commonly recommended) helps maintain protein stability during freeze-thaw cycles .

How should I reconstitute lyophilized UPF0283 membrane protein for experiments?

For optimal reconstitution of lyophilized UPF0283 membrane protein, follow this methodological approach:

  • Briefly centrifuge the vial before opening to ensure content collection at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Prepare aliquots of the reconstituted protein for long-term storage at -20°C/-80°C

This protocol minimizes protein degradation while maintaining stability for experimental applications . For solution stability, Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been used successfully for similar UPF0283 membrane proteins .

What expression system is commonly used for producing recombinant UPF0283 membrane protein?

Escherichia coli (E. coli) is the predominantly used expression system for producing recombinant UPF0283 membrane protein. Available commercial preparations utilize E. coli as their expression host, taking advantage of its:

  • Rapid growth kinetics and high protein yield potential

  • Well-established transformation and protein induction protocols

  • Compatibility with various affinity tags (particularly His-tags) for efficient purification

  • Cost-effectiveness compared to eukaryotic expression systems

The commercially available recombinant UPF0283 membrane protein preparations are typically produced with N-terminal His-tags to facilitate purification using metal affinity chromatography .

What experimental approaches can be used to study the structural characteristics of UPF0283 membrane protein?

Several sophisticated experimental approaches can be employed to elucidate the structural characteristics of UPF0283 membrane protein:

  • X-ray Crystallography: This approach can provide high-resolution structural information, similar to methods used for other membrane protein complexes:

    • Requires purification to >85% homogeneity as verified by SDS-PAGE

    • May necessitate screening multiple crystallization conditions

    • Data collection parameters similar to those used for EMC complex (wavelength ~0.9-2.7 Å)

    • Structure determination through molecular replacement or experimental phasing methods

  • Computational Structure Prediction:

    • Ab initio modeling using platforms such as Robetta

    • Template-based modeling when homologous structures are available

    • Model validation through biochemical experiments

  • Protein Structure Analysis:

    • Analysis of bond lengths (typical deviations ~0.007 Å)

    • Bond angle analysis (typical deviations ~0.85°)

    • B-factor analysis to identify flexible regions

Table: Typical Data Collection Parameters for Membrane Protein Crystallography

ParameterTypical Range
X-ray wavelength0.9-2.7 Å
Resolution range2.2-2.7 Å
R-factors (Rwork/Rfree)20-25%
I/σ(I)>1.8
Completeness>98%

These approaches can be complemented with spectroscopic methods such as circular dichroism for secondary structure analysis and nuclear magnetic resonance for dynamics studies .

How can I design experiments to investigate potential binding partners of UPF0283 membrane protein?

Designing experiments to identify and characterize binding partners of UPF0283 membrane protein requires a systematic approach:

  • Affinity Purification Coupled with Mass Spectrometry:

    • Use His-tagged UPF0283 (available as product CSB-EP820710YAS1 or RFL21864YF) as bait

    • Perform pull-down experiments from Yersinia lysates

    • Analyze co-purifying proteins by mass spectrometry

    • Include appropriate controls (unrelated His-tagged proteins) to identify non-specific interactions

  • Yeast Two-Hybrid Screening:

    • Design constructs without transmembrane regions if they interfere with nuclear localization

    • Screen against Yersinia cDNA library

    • Validate positive interactions with secondary assays

    • Apply statistical analysis similar to experimental design studies (ANOVA, p < 0.05) to evaluate interaction significance

  • Experimental Design Considerations:

    • Implement factorial experimental design to efficiently test interaction conditions

    • Analyze results using statistical methods similar to EDAT analysis (F-test, p < 0.05)

    • Include experimental and comparison groups with appropriate sample sizes for statistical power

    • Employ pre-test/post-test analysis to validate findings

  • Data Analysis and Validation:

    • Apply statistical methods similar to those used in experimental design studies:

      • ANOVA for comparing multiple conditions (F(1, 1164) = 17.369, p = 0.013)

      • Evaluate interaction significance using appropriate statistical thresholds (p < 0.05)

      • Report means (M) and standard errors (SE) for quantitative measurements

This methodological framework provides a robust approach to identifying physiologically relevant binding partners of UPF0283 membrane protein.

What are the challenges in crystallizing UPF0283 membrane protein for structural studies?

Crystallizing membrane proteins like UPF0283 presents several significant challenges that require specialized methodological approaches:

  • Protein Stability and Homogeneity Challenges:

    • Membrane proteins often contain flexible regions that impede crystallization

    • Solution: Consider implementing limited proteolysis to remove flexible segments while preserving the core structure

    • Apply size-exclusion chromatography to ensure monodispersity before crystallization trials

  • Crystallization Condition Optimization:

    • Based on successful membrane protein crystallization data, consider:

      • Testing multiple space groups (P21212 has been successful for other membrane proteins)

      • Optimizing unit cell parameters similar to those used for EMC complexes (a, b, c ≈ 50-85 Å)

      • Aiming for resolution in the 2.2-2.7 Å range

  • Data Collection and Processing Considerations:

    • Target data collection statistics similar to successful membrane protein structures:

      • Completeness >99%

      • I/σ(I) >1.8

      • CC1/2 >80%

      • Resolution around 2.2-2.7 Å

  • Refinement Strategies:

    • Aim for R-factors (Rwork/Rfree) around 20-25%

    • Optimize bond length deviations to ~0.007 Å

    • Maintain bond angle deviations around 0.85°

Table: Comparison of Crystallization Approaches for Membrane Proteins

ParameterTraditional Vapor DiffusionLipidic Cubic PhaseBicelle Method
Detergent requirementHighMinimalModerate
Native-like environmentLowHighMedium
Crystal packingType I (small contacts)Type I/II (varied)Type I/II (varied)
Typical resolution2.5-3.5 Å1.8-2.5 Å2.0-3.0 Å

Successful crystallization may require specialized synchrotron facilities similar to those used for EMC complex studies (e.g., Diamond I03, I23) and phasing methods like molecular replacement or S-SAD phasing .

How can I optimize experimental design to study UPF0283 membrane protein function?

Optimizing experimental design for studying UPF0283 membrane protein function requires rigorous methodological approaches:

  • Statistical Design Considerations:

    • Implement a factorial experimental design similar to approaches used in educational research:

      • 2 (group: experimental/comparison) × 2 (test: pre-test/post-test) ANOVA

      • Analyze results using appropriate statistical tests (F-tests with p < 0.05 for significance)

      • Report effect sizes along with p-values for comprehensive analysis

  • Sample Size and Power Analysis:

    • Base sample size on power analysis similar to educational research studies:

      • Aim for sample sizes comparable to those in related studies (n > 1000 for robust statistics)

      • Calculate statistical power to detect meaningful differences

      • Report means (M) and standard errors (SE) for all measurements

  • Factor Analysis Approach:

    • Analyze experimental data using factor analysis to identify:

      • Basic understanding components (Factor 1)

      • Advanced understanding components (Factor 2)

      • Apply similar statistical thresholds as in educational research:

        • F(1, 1164) > 9.0, p < 0.05 for significant effects

  • Control Group Design:

    • Include appropriate control groups similar to educational research designs:

      • Comparison group receiving standard treatment

      • Experimental group receiving novel interventions

      • Pre-test and post-test measurements for both groups

This methodological framework provides a statistically robust approach to studying UPF0283 membrane protein function, drawing on established experimental design principles from related scientific fields.

What methodological approaches can be used to study the EMC-like properties of UPF0283 membrane protein?

The ER Membrane Protein Complex (EMC) represents a critical insertion pathway for transmembrane proteins. Given that UPF0283 is also a membrane protein, several methodological approaches can be applied to investigate potential EMC-like properties:

  • Structural Homology Analysis:

    • Apply reference-free ab initio modeling using Robetta (similar to EMC8/EMC9 analysis)

    • Evaluate structural alignment with RMSD measurements (target <2.3 Å for significant homology)

    • Perform template-based modeling with known structures as references (aim for RMSD <0.6 Å)

    • Assess fit quality with no steric violations when docked into predicted complexes

  • Protein-Protein Interaction Studies:

    • Investigate potential interactions with components of membrane insertion machinery

    • Use docking simulations to predict interaction interfaces

    • Validate models through mutagenesis of predicted interface residues

  • Crystallographic Analysis:

    • If structural studies are pursued, aim for data collection parameters comparable to EMC complex:

      • Resolution: 2.2-2.7 Å

      • Completeness: >99%

      • I/σ(I): >1.8

      • CC1/2: >80%

Table: Data Collection Parameters Comparison for Membrane Protein Complexes

ParameterEMC ComplexTarget for UPF0283 Studies
Resolution range2.2-2.7 Å2.0-3.0 Å
Completeness>99%>95%
I/σ(I)>1.8>1.5
CC1/2>80%>75%
R-factors20-25%<30%

By applying these methodologies, researchers can investigate whether UPF0283 membrane protein shares functional or structural properties with known membrane protein insertion complexes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.