Recombinant UPF0283 protein YcjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant UPF0283 protein YcjF (ycjF) is a protein of unknown function belonging to the UPF0283 family . It is found in various bacteria, including Escherichia coli and Salmonella agona . The protein is also found in Yersinia enterocolitica. YcjF is a multi-pass membrane protein located in the cell's inner membrane. Recombinant YcjF proteins are produced for research purposes in different expression systems such as E. coli, yeast, baculovirus, and mammalian cells .

Characteristics

  • Synonyms: ycjF, UPF0283 protein YcjF

  • Families: UPF0283 family

  • Subcellular Location: Cell inner membrane; Multi-pass membrane protein

  • Source Organisms: Escherichia coli, Salmonella agona, Yersinia enterocolitica

Production

Recombinant YcjF proteins can be produced using several expression systems:

  • E. coli

  • Yeast

  • Baculovirus

  • Mammalian cells

Recombinant proteins are often expressed with a tag, located at the N-terminus or C-terminus . The tag type is determined during the manufacturing process .

Structure and Function

YcjF is a membrane protein of the UPF0283 family . The E. coli YcjF consists of 353 amino acids . Homologs of YcjF are found in various bacterial species . The precise function of YcjF is currently unknown, but it is annotated as a UPF0283 membrane protein .

Applications

Recombinant YcjF proteins are used in research, including ELISA assays .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; UPF0283 protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Yersinia enterocolitica
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFEQPLQPIDEPVLKAAQAFDQHAAENFYPADPELDAENEEGRVEGLVNAA LKPKRSLWRKMVTVGIALFGVSVIAQSVQWVNQAWQQQDWIALGATTAGGLIVLAGVGSV VTEWRRLYRLRQRAEERDIARELLVSHGIGQGRAFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPSLDNLARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLGDDKPKLGDFRRQLIGQLKNTLPKKDKPAQQ
Uniprot No.

Target Background

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0283 protein YcjF and what is its biological significance?

UPF0283 protein YcjF is a membrane protein primarily found in various bacterial species, notably Escherichia coli. It consists of approximately 353 amino acids and is classified as a membrane protein . The "UPF" designation (Uncharacterized Protein Family) indicates that its precise function remains to be fully characterized.

YcjF is conserved across several bacterial species, suggesting evolutionary importance. While its exact biological function is still under investigation, research suggests potential involvement in bacterial stress responses and two-component signaling systems . The membrane localization of YcjF indicates possible roles in membrane integrity, transport mechanisms, or signaling pathways.

Which bacterial species and strains express YcjF protein?

YcjF is found in multiple gram-negative bacteria, with well-characterized variants identified in:

  • Escherichia coli strains:

    • K12/DH10B strain

    • K12/MC4100/BW2952 strain

    • IAI1 strain

    • UTI89/UPEC strain

    • O6 strain

  • Salmonella typhimurium

  • Yersinia enterocolitica

The protein exhibits high sequence conservation among enterobacteria, with strain-specific variations potentially corresponding to adaptations to different ecological niches or pathogenic potentials. Each variant has specific amino acid sequences that can be expressed recombinantly for research purposes.

How should experimental design be approached for YcjF protein research?

When designing experiments involving YcjF protein, researchers should apply systematic experimental design principles:

  • Define clear research objectives: Determine whether you're investigating structure, function, interactions, or expression patterns

  • Control variables: In line with experimental design principles, identify:

    • Independent variables (e.g., expression conditions, detergent types)

    • Dependent variables (e.g., protein yield, purity, activity)

    • Controlled variables (e.g., temperature, pH, buffer composition)

  • Include appropriate controls:

    • Positive controls (known functional protein)

    • Negative controls (non-expressing vectors, unrelated membrane proteins)

    • System controls (host strain without insert)

  • Statistical considerations:

    • Determine appropriate sample sizes through power analysis

    • Plan for biological and technical replicates (minimum n=3)

    • Select appropriate statistical tests based on data distribution

A factorial experimental design approach is often beneficial when optimizing multiple parameters simultaneously (expression temperature, inducer concentration, detergent type) . This allows systematic exploration of parameter interactions while minimizing experiment numbers.

What expression systems are most effective for producing functional YcjF?

Several expression systems can be used for YcjF production with varying advantages:

Expression SystemAdvantagesConsiderationsTypical Yields
E. coliMost commonly used, rapid growth, high yieldsMay require specialized strains for membrane proteinsVaries by strain
YeastEukaryotic processing, different membrane compositionSlower growth than bacteriaModerate
BaculovirusHigh capacity for foreign genesComplex setup, longer timelineGood for structural studies
Mammalian CellMost sophisticated folding machineryHighest cost, typically lower yieldsLimited applications

For YcjF, E. coli expression systems are frequently employed as indicated by multiple commercial sources . The source organism can vary by application:

  • E. coli expression for basic studies and bacterial proteins

  • Baculovirus systems when higher purity is required (>85% purity via SDS-PAGE)

For optimal expression in E. coli:

  • Select specialized strains designed for membrane proteins

  • Consider reduced temperature induction (16-25°C)

  • Optimize inducer concentration and induction timing

  • Use rich media formulations to maximize biomass

What purification strategies are recommended for recombinant YcjF?

Purifying membrane proteins like YcjF presents unique challenges requiring specialized approaches:

Extraction and Solubilization:

  • Harvest cells and create spheroplasts or directly lyse cells

  • Solubilize membrane fractions using detergents (commonly DDM, LDAO, or OG)

  • Screen multiple detergents at various concentrations for optimal solubilization

Purification Steps:

  • Affinity Chromatography: Most recombinant YcjF proteins utilize His-tags for IMAC purification

  • Size Exclusion Chromatography: Separates properly folded protein from aggregates

  • Ion Exchange: Optional additional purification step depending on purity requirements

Buffer Considerations:

  • Maintain detergent above CMC throughout purification

  • Include stabilizers such as glycerol (typically 5-50%)

  • Consider lipid supplementation to maintain native-like environment

Following purification, protein quality should be assessed using SDS-PAGE (target purity >85-95%) and other methods to verify structural integrity.

What are the optimal storage conditions for recombinant YcjF?

Based on commercial product specifications and standard practices for membrane proteins:

Short-term Storage (up to 1 week):

  • Temperature: 4°C

  • Buffer composition: Tris-based buffer with appropriate detergent

Long-term Storage:

  • Temperature: -20°C to -80°C

  • Formulation: Either liquid with 50% glycerol or lyophilized powder

  • Aliquoting: Divide into single-use aliquots to prevent freeze-thaw cycles

Critical Storage Recommendations:

  • Avoid repeated freezing and thawing as this significantly reduces protein stability

  • For reconstitution of lyophilized protein, use deionized sterile water to achieve 0.1-1.0 mg/mL concentration

  • Consider adding glycerol to a final concentration of 5-50% for freezing stability

The shelf life of liquid formulations is typically 6 months at -20°C/-80°C, while lyophilized forms generally maintain stability for 12 months at -20°C/-80°C .

How can structural studies of YcjF be approached?

Structural characterization of membrane proteins like YcjF requires specialized techniques:

X-ray Crystallography:

  • Requires highly pure protein in detergent micelles or lipidic cubic phases

  • May necessitate construct optimization (removing flexible regions)

  • Often requires screening hundreds of crystallization conditions

Cryo-Electron Microscopy:

  • Increasingly powerful for membrane protein structures

  • Can visualize proteins in more native-like environments

  • May be combined with lipid nanodiscs

Computational Approaches:

  • AlphaFold2 and similar prediction tools can provide initial structural models

  • Molecular dynamics simulations can model membrane interactions

  • Integrative modeling can combine data from multiple experimental techniques

When approaching structural studies, researchers often need to optimize constructs by removing flexible regions or creating fusion proteins to aid crystallization. For YcjF, its membrane association presents additional challenges requiring careful detergent selection during purification and crystallization attempts.

What evidence suggests YcjF involvement in two-component signaling systems?

Recent research indicates potential roles for YcjF in bacterial two-component signaling systems:

  • Co-purification evidence: YcjF has been identified in membrane protein pull-down experiments alongside histidine kinases of two-component systems

  • Expression correlation: The ycjF gene shows expression patterns consistent with stress-response elements regulated by two-component systems

  • Structural features: The membrane localization of YcjF positions it appropriately for potential interactions with membrane-bound histidine kinases

  • Functional indicators: Genetic studies suggest YcjF may influence phosphotransfer processes or signal transduction

Research approaches to further investigate these connections include:

  • FRET microscopy to identify in vivo interactions between YcjF and two-component system components

  • Transcriptomic analysis to identify co-regulated genes

  • Promoter activation studies to measure functional effects

  • Direct binding assays with purified components

How should contradictions in YcjF experimental data be addressed?

When facing contradictory results in YcjF research, a systematic troubleshooting approach is essential:

  • Identify potential sources of variation:

    • Different bacterial strains with variant YcjF sequences

    • Expression system differences

    • Purification method variations

    • Assay condition discrepancies

  • Validation experiments:

    • Repeat key experiments with standardized protocols

    • Use multiple complementary assays to assess the same property

    • Compare results with positive and negative controls

  • Systematic variable isolation:

    • Change one variable at a time to identify critical factors

    • Design experiments following a factorial approach to identify interaction effects

  • Literature-based reconciliation:

    • Analyze methodological differences between conflicting reports

    • Consider biological variability across bacterial strains

    • Examine differences in experimental conditions

For example, contradictions in protein-protein interaction studies might be resolved by:

  • Testing interactions in multiple buffer conditions

  • Using both in vitro and in vivo approaches

  • Verifying protein quality before each experiment

  • Controlling for tag interference effects

What functional assays can be employed to study YcjF?

Although the precise function of YcjF remains uncharacterized, several approaches can be used to investigate its activity:

Membrane Association Studies:

  • Liposome binding assays

  • Fluorescence microscopy with tagged YcjF

  • Subcellular fractionation and Western blotting

Interaction Mapping:

  • Pull-down assays with potential binding partners

  • Bacterial two-hybrid screens

  • Cross-linking followed by mass spectrometry

  • FRET-based interaction assays

Phenotypic Characterization:

  • Growth curves of ycjF deletion mutants under various stress conditions

  • Comparative transcriptomics of wild-type vs. ycjF mutants

  • Membrane integrity assays (fluorescent dye uptake)

  • Sensitivity testing to antimicrobial compounds

Biochemical Activity Screening:

  • ATP/GTP binding and hydrolysis assays

  • Phosphorylation state analysis

  • Lipid binding assays

  • Ion transport measurements in reconstituted systems

These assays should be performed with appropriate controls and statistical analysis to ensure reproducibility and meaningful interpretation of results.

How can researchers verify the quality of recombinant YcjF preparations?

Comprehensive quality assessment of recombinant YcjF should include:

Purity Assessment:

  • SDS-PAGE: Standard method showing >85-95% purity on Coomassie-stained gels

  • Western blotting: Using anti-tag or anti-YcjF antibodies for specific detection

  • Size exclusion chromatography: To assess homogeneity and oligomeric state

Identity Confirmation:

  • Mass spectrometry: To confirm protein identity and detect modifications

  • N-terminal sequencing: To verify the correct start site

  • Immunological detection: Using specific antibodies

Functional Validation:

  • Circular dichroism: To verify secondary structure content

  • Thermal shift assays: To assess protein stability

  • Interaction assays with known binding partners (when established)

  • Reconstitution into liposomes to verify membrane integration

A typical quality control workflow would progress from basic purity checks (SDS-PAGE) to more sophisticated structural and functional validations based on the intended application of the protein.

What are the key considerations when designing YcjF mutants for structure-function studies?

When designing YcjF variants for structure-function analysis:

Studies on related proteins have successfully employed compensatory mutation approaches to restore interaction partnerships, which could be adapted for YcjF research .

How might YcjF research contribute to understanding bacterial signaling networks?

YcjF research has significant potential to advance our understanding of bacterial signaling:

  • Integration with two-component systems:

    • Evidence suggests YcjF may interact with histidine kinases in membrane protein complexes

    • This could reveal new mechanisms of signal integration or modulation

    • Understanding these interactions may uncover novel regulatory circuits

  • Stress response pathways:

    • YcjF may participate in membrane-associated stress responses

    • Characterizing its function could identify new signaling branches

    • This might reveal previously unknown adaptation mechanisms

  • Evolutionary conservation implications:

    • The conservation of YcjF across bacterial species suggests fundamental importance

    • Comparative studies across species could reveal environment-specific adaptations

    • This evolutionary perspective may highlight essential bacterial processes

  • Methodological advances:

    • YcjF research drives development of membrane protein analysis techniques

    • This includes approaches like AlphaFold2 structure prediction and validation workflows

    • These methods benefit the broader field of bacterial protein research

Future research should focus on establishing definitive functional roles for YcjF through integrated genetic, biochemical, and structural approaches.

What experimental approaches can determine if YcjF has potential as a therapeutic target?

Evaluating YcjF as a potential therapeutic target requires systematic investigation:

  • Essentiality assessment:

    • Create clean deletion mutants in model bacterial systems

    • Evaluate growth and fitness under various conditions

    • Conduct competition assays to measure relative fitness costs

  • Structural druggability analysis:

    • Identify potential binding pockets using computational approaches

    • Assess conservation of these pockets across bacterial species

    • Evaluate structural accessibility of potential binding sites

  • Functional significance:

    • Determine if YcjF contributes to virulence or pathogenicity

    • Assess impact on stress responses or antimicrobial resistance

    • Measure effects of YcjF disruption on host-pathogen interactions

  • Target validation:

    • Develop tool compounds that bind to YcjF

    • Measure phenotypic effects of these compounds

    • Compare effects to genetic deletion phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.