Recombinant UPF0295 protein BA_0538/GBAA_0538/BAS0506 (BA_0538, GBAA_0538, BAS0506)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression and tag details

ParameterSpecificationSource
Expression HostE. coli
Tag TypeN-terminal His-tag
Protein FormLyophilized powder
Storage BufferTris-based buffer with 50% glycerol (pH 8.0)

Handling recommendations

  1. Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL), with optional 5–50% glycerol for long-term storage .

  2. Storage: -20°C/-80°C; avoid repeated freeze-thaw cycles .

Research Applications and Gaps

Potential uses

  • Vaccine development: As a target antigen for anthrax research .

  • Antibody production: His-tag facilitates affinity purification for immunological studies .

  • Structural biology: Full-length sequence enables crystallography or cryo-EM studies .

Notable limitations

  • Functional data: No explicit pathways or interacting proteins are documented in available literature .

  • Therapeutic context: No clinical trials or efficacy studies reported .

Quality Control and Documentation

Optimized protocols

ConditionRecommendationSource
Short-term4°C (up to 1 week)
Long-term-20°C/-80°C with 50% glycerol
Freeze-thaw cyclesAvoid; aliquot before storage

Future Research Directions

  1. Functional characterization: Elucidating its role in B. anthracis pathogenesis.

  2. Interaction mapping: Identifying binding partners using yeast two-hybrid assays.

  3. Therapeutic targeting: Assessing immunogenicity for vaccine development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Shipping defaults to standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BA_0538; GBAA_0538; BAS0506; UPF0295 protein BA_0538/GBAA_0538/BAS0506
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
BA_0538
Target Protein Sequence
MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS
Uniprot No.

Target Background

Database Links

KEGG: ban:BA_0538

STRING: 260799.BAS0506

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and reconstitution conditions for recombinant UPF0295 protein?

For optimal preservation of recombinant UPF0295 protein BA_0538 activity:

Storage recommendations:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage .

How is recombinant UPF0295 protein BA_0538 produced and purified?

Recombinant UPF0295 protein BA_0538/GBAA_0538/BAS0506 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The production workflow follows these general steps:

  • Cloning of the BA_0538 gene (encoding amino acids 1-118) into an expression vector with an N-terminal His-tag

  • Transformation into competent E. coli cells

  • Induction of protein expression under optimized conditions

  • Cell lysis and extraction of total protein

  • Affinity purification using His-tag binding resins

  • Quality control assessment:

    • SDS-PAGE for purity verification (typically >90%)

    • Western blot for specificity confirmation

    • Mass spectrometry for identity confirmation

  • Lyophilization for stable storage

The final product is typically validated to have a purity greater than 90% as determined by SDS-PAGE analysis .

What experimental design approaches are recommended for characterizing unknown function proteins like UPF0295?

When designing experiments to characterize proteins of unknown function like UPF0295, a systematic approach incorporating multiple experimental designs is recommended:

Recommended experimental design hierarchy:

Design TypeExperimental ApproachAdvantages
A. Single-group designsOne-group pretest-posttest with double pretestHelps refute regression to the mean effects
B. Control group designs without pretestPosttest-only design with nonequivalent groupsControls for external factors
C. Control group designs with pretestUntreated control with dependent samplesAssesses initial comparability of groups
D. Time-series designsMultiple measurements before and after interventionRobust against temporal confounders

For UPF0295 protein specifically, consider implementing:

  • Comparative interactome analysis: Using techniques like co-immunoprecipitation followed by mass spectrometry to identify protein binding partners

  • Gene knockout/knockdown studies: Assess phenotypic changes in Bacillus anthracis when BA_0538 is deleted or suppressed

  • Localization studies: Determine subcellular localization using fluorescent tagging or immunocytochemistry

  • Structural analysis: Apply X-ray crystallography or cryo-EM to determine three-dimensional structure

Implement the experimental control design notation from the established hierarchy to ensure replicability and validity of findings .

How can researchers validate antibody specificity when studying UPF0295 protein BA_0538?

Antibody validation is critical for accurate UPF0295 protein detection. A comprehensive validation protocol should include:

  • Western blot analysis:

    • Compare recombinant UPF0295 protein as positive control

    • Include knockout/knockdown samples as negative controls

    • Verify expected molecular weight (approximately 13 kDa plus tag size)

  • Cross-reactivity assessment:

    • Test against closely related UPF0295 family proteins from other species

    • Examine reactivity with homologs like Geobacillus thermodenitrificans UPF0295 (GTNG_0491)

  • Immunoprecipitation efficiency:

    • Quantify protein recovery percentages

    • Verify specificity using mass spectrometry

  • Epitope mapping:

    • Identify specific binding regions within BA_0538 sequence

    • Avoid antibodies targeting highly conserved regions if specificity is required

These validation steps are essential as poor antibody specificity has been identified as a major contributor to irreproducibility in biological research. Following standardized antibody validation protocols significantly improves experimental reliability and reproducibility .

What quasi-experimental approaches are most appropriate for studying UPF0295 protein in complex biological systems?

When investigating UPF0295 protein in complex biological systems where randomization may not be feasible, several quasi-experimental designs offer robust alternatives:

Recommended quasi-experimental designs:

Design CategorySpecific DesignNotationApplication for UPF0295
Time-series designsInterrupted time-seriesO₁ O₂ O₃ X O₄ O₅ O₆Track UPF0295 expression patterns before and after stimuli
Removed treatment designsABA designO₁ X O₂ remove-X O₃Test reversibility of UPF0295-mediated effects
Nonequivalent control designsSwitching replicationsGroup 1: O₁ X O₂ O₃
Group 2: O₁ O₂ X O₃
Compare UPF0295 effects across different cell populations

When implementing these designs, researchers should:

  • Define clear operational measurements (O)

  • Precisely characterize interventions (X)

  • Document any temporal trends in UPF0295 expression or activity

  • Account for potential confounding variables

  • Include appropriate statistical controls for regression to the mean

To strengthen validity, researchers should acknowledge design limitations explicitly and consider combining multiple quasi-experimental approaches to triangulate findings .

How can comparative protein analysis between UPF0295 homologs inform functional studies?

Comparative analysis between UPF0295 protein BA_0538 and homologous proteins provides valuable insights for functional characterization:

Comparison of selected UPF0295 family proteins:

ProteinSpeciesLengthSequence SimilarityHost ExpressionUniProt ID
BA_0538/GBAA_0538/BAS0506Bacillus anthracis118 aaReferenceE. coliQ81YU3
GTNG_0491Geobacillus thermodenitrificans117 aaHigh similarityE. coliA4IKD1
YgzBBacillus subtilis~120 aaModerate similarityMultiple systemsP54556
BPUM_0828Bacillus pumilus~118 aaModerate similarityE. coliA8FA88

To leverage this comparative approach:

  • Phylogenetic analysis: Construct evolutionary trees of UPF0295 proteins to identify conserved regions

  • Domain mapping: Identify functional domains conserved across homologs

  • Expression pattern comparison: Compare expression profiles under similar conditions

  • Complementation studies: Test functional interchangeability between homologs

  • Structural alignment: Compare predicted or determined structures to infer functional sites

This comparative approach can reveal evolutionarily conserved functions and species-specific adaptations, providing direction for targeted functional studies .

What protocol design considerations are essential for studying potentially membrane-associated proteins like UPF0295?

Designing protocols for membrane-associated proteins like UPF0295 requires specialized considerations:

Protocol design framework:

  • Sample preparation:

    • Use detergent screening to identify optimal solubilization conditions

    • Test multiple detergents (e.g., DDM, CHAPS, SDS) at varying concentrations

    • Consider native membrane mimetics (nanodiscs, liposomes) for functional assays

  • Purification strategy:

    • Implement gentle extraction procedures to preserve native conformation

    • Use two-phase partitioning for initial enrichment

    • Apply affinity chromatography with imidazole gradient elution for His-tagged UPF0295

  • Activity assays:

    • Design assays compatible with detergent presence

    • Include appropriate controls for detergent interference

    • Consider reconstitution into proteoliposomes for functional studies

  • Data analysis:

    • Account for detergent background in spectroscopic measurements

    • Apply appropriate normalization for membrane protein yields

    • Use specific statistical approaches for handling membrane protein variability

A comprehensive protocol must be sufficiently detailed to allow replication by other researchers while acknowledging potential limitations associated with membrane protein handling and stability .

What approaches can be used to investigate potential roles of UPF0295 protein in unfolded protein response pathways?

Given the UPF designation and potential association with unfolded protein response (UPR) pathways, specialized approaches may be valuable:

  • UPR induction studies:

    • Expose cells to known UPR inducers (tunicamycin, thapsigargin)

    • Monitor UPF0295 expression changes using RT-qPCR and western blotting

    • Compare responses to established UPR markers

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and interactomics data

    • Apply pathway enrichment analysis to position UPF0295 within UPR networks

    • Use GSEA (Gene Set Enrichment Analysis) to identify associated pathways

  • UPR signature development:

    • Develop a UPR-related gene signature incorporating UPF0295

    • Validate signature across multiple stress conditions

    • Apply signature for predictive modeling of stress responses

  • Structure-function analysis:

    • Examine potential stress-responsive domains within UPF0295

    • Perform mutagenesis of conserved motifs to assess functional importance

    • Investigate potential redox-sensitive residues (note the cysteine residues in position 62 and 66)

These approaches can help position UPF0295 within the broader context of cellular stress response mechanisms and provide insights into its functional significance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.