Recombinant UPF0299 membrane protein YPTB1529 (YPTB1529)

Shipped with Ice Packs
In Stock

Description

Despite limited direct studies, YPTB1529’s structural features align with outer membrane protein (OMP) dynamics observed in related systems:

  • Membrane Protein Assembly: The BAM (β-barrel assembly machinery) complex, critical for OMP biogenesis, demonstrates sequential substrate recognition . While YPTB1529 is not directly linked to BAM, its membrane localization suggests potential interactions with such systems.

  • Dynamics and Stability: Solid-state NMR studies on Klebsiella pneumoniae OmpA reveal β-barrel motions and loop flexibility, which may parallel YPTB1529’s structural behavior .

Current applications likely focus on:

  1. Antibody Development: ELISA-grade recombinant proteins (e.g., 50 µg quantities) support serological studies .

  2. Structural Biology: Full-length His-tagged versions enable crystallization or cryo-EM studies to resolve transmembrane conformations .

Comparative Analysis with Related Proteins

While YPTB1529 lacks homologs with annotated functions, its UPF0299 classification suggests conserved membrane roles. Key distinctions:

FeatureYPTB1529General OMPs (e.g., OmpC, OmpA)
Length135 aaVaries (e.g., 300–400 aa)
TagHis-tag (N-terminal)Varies (e.g., GST, MBP)
Expression HostE. coli, cell-freeE. coli, yeast, insect cells
Functional DataHypotheticalTransport, adhesion, immune evasion

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YPTB1529; UPF0299 membrane protein YPTB1529
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
YPTB1529
Target Protein Sequence
MRNMMSLCWQYLRAFTIIYLCLWAGKALALLLPIVIPGSIIGMLILFVLLTLQILPSPWV KPSCQLLIRYMALLFVPIGVGVMQYYEQLTKQFGPIVVSCFISTLIVMLVVAYSSHYVHR DRKVISPSTPTEGEK
Uniprot No.

Target Background

Database Links

KEGG: ypo:BZ17_986

Protein Families
UPF0299 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.