Recombinant UPF0316 protein BA_3420/GBAA_3420/BAS3170 (BA_3420, GBAA_3420, BAS3170)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BA_3420; GBAA_3420; BAS3170; UPF0316 protein BA_3420/GBAA_3420/BAS3170
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
BA_3420
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH VS
Uniprot No.

Target Background

Database Links

KEGG: ban:BA_3420

STRING: 260799.BAS3170

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0316 protein BA_3420/GBAA_3420/BAS3170?

UPF0316 protein BA_3420/GBAA_3420/BAS3170 is an uncharacterized protein from Bacillus anthracis. The multiple identifiers (BA_3420, GBAA_3420, BAS3170) represent the same protein in different strain annotations or database entries of Bacillus anthracis. According to available information, it's a full-length protein consisting of 182 amino acids that belongs to the UPF0316 family of proteins with unknown function .

How is recombinant BA_3420/GBAA_3420/BAS3170 produced?

Recombinant BA_3420/GBAA_3420/BAS3170 is typically produced using E. coli expression systems. The general methodology involves:

  • Gene cloning from Bacillus anthracis genomic DNA using PCR

  • Vector construction with a C-terminal 6-His tag for purification

  • Transformation into E. coli expression strains

  • Induction of protein expression under optimized conditions

  • Protein purification via affinity chromatography using Ni-NTA resin

  • Quality verification through SDS-PAGE and other analytical methods

Current commercial preparations provide the full-length protein (amino acids 1-182) with a His-tag for research applications .

What is known about the structure and potential function of UPF0316 family proteins?

The UPF (Uncharacterized Protein Family) 0316 designation indicates that the function of these proteins remains largely unknown. Based on standard bioinformatic analyses, these proteins:

  • Are conserved across various Bacillus species

  • Likely possess a globular domain structure

  • May be involved in species-specific cellular processes

Without experimental characterization, functions are primarily inferred through computational approaches such as homology modeling, genomic context analysis, and phylogenetic profiling.

What expression systems are optimal for BA_3420/GBAA_3420/BAS3170 production?

While E. coli is currently the standard expression system as indicated in the product information , researchers should consider these methodological options for optimization:

Expression SystemAdvantagesLimitationsRecommendations
E. coli BL21(DE3)High yield, established protocolsPotential for inclusion bodiesStandard approach for initial studies
E. coli RosettaAddresses codon bias issuesHigher costConsider if expression levels are low
B. subtilisNative-like posttranslational modificationsMore complex protocolsFor functional studies requiring authentic structure
Cell-free systemsAvoids toxicity, rapid productionHigher cost, lower yieldFor proteins toxic to host cells

For optimal protein quality:

  • Test multiple induction temperatures (18°C, 25°C, 37°C)

  • Vary IPTG concentrations (0.1-1.0 mM)

  • Evaluate solubility enhancement with fusion tags (MBP, SUMO)

  • Consider co-expression with molecular chaperones

How should researchers design experiments to elucidate the function of BA_3420/GBAA_3420/BAS3170?

For uncharacterized proteins like BA_3420/GBAA_3420/BAS3170, a systematic approach includes:

In silico analysis:

  • Sequence analysis for conserved motifs and domains

  • Structural prediction using tools like AlphaFold

  • Genomic context analysis (examining neighboring genes)

Expression pattern analysis:

  • qRT-PCR under various growth conditions

  • Transcriptomic analysis to identify co-regulated genes

Interaction studies:

  • Pull-down assays using the His-tagged protein

  • Crosslinking coupled with mass spectrometry

  • Bacterial two-hybrid screening

Phenotypic studies:

  • Generation of knockout mutants

  • Complementation assays

  • Growth under various stress conditions

Biochemical characterization:

  • Substrate screening for potential enzymatic activity

  • Binding assays for nucleic acids and other biomolecules

  • Post-translational modification analysis

How can researchers assess the structural integrity of recombinant BA_3420/GBAA_3420/BAS3170?

Ensuring structural integrity is crucial for functional studies. A comprehensive approach includes:

Basic verification:

  • SDS-PAGE to confirm molecular weight (expected ~20 kDa plus tag)

  • Western blotting using anti-His antibodies

  • Mass spectrometry for exact mass determination

Structural analysis:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Size exclusion chromatography to verify monomeric/oligomeric state

  • Dynamic light scattering for homogeneity assessment

Advanced characterization:

  • Differential scanning fluorimetry (DSF) for thermal stability

  • Limited proteolysis to probe domain architecture

  • FTIR spectroscopy for complementary secondary structure information

For publication-quality structural characterization, researchers should consider X-ray crystallography or cryo-electron microscopy if the protein is amenable to these techniques.

What approaches can help resolve data contradictions when studying uncharacterized proteins like BA_3420/GBAA_3420/BAS3170?

When working with uncharacterized proteins, contradictory results are common. Addressing these effectively requires:

Contradiction identification and classification:

  • Apply the (α, β, θ) notation system from data quality research , where:

    • α represents the number of interdependent data items

    • β represents the number of contradictory dependencies

    • θ represents the minimum number of Boolean rules needed

Methodological validation:

  • Compare experimental methods for systematic biases

  • Assess statistical significance of contradictory results

  • Evaluate reproducibility across different laboratories

Integration strategies:

  • Design critical experiments specifically targeting contradictions

  • Use orthogonal techniques for independent verification

  • Implement Bayesian data integration with confidence weighting

Decision framework example:

Contradiction TypeExampleResolution StrategySuccess Metrics
Structural propertyDifferent secondary structure predictionsCD spectroscopy, FTIR, X-rayConsensus across multiple methods
Binding partnerContradictory pull-down resultsCrosslinking MS, SPR, ITCConfirmation under physiological conditions
LocalizationDifferent subcellular predictionsFractionation, fluorescent taggingConsistent results with multiple approaches

How does BA_3420/GBAA_3420/BAS3170 compare to homologous proteins in other Bacillus species?

Comparative analysis provides evolutionary context that can inform functional hypotheses:

Sequence comparison methodology:

  • Identify homologs using BLAST against microbial genomes

  • Create multiple sequence alignments

  • Construct phylogenetic trees

  • Calculate conservation scores for each residue

  • Identify species-specific insertions/deletions

Conservation analysis table:

SpeciesProtein IDSequence IdentityNotable Features
B. anthracisBA_3420100% (reference)Full-length, 182 aa
B. cereusBC_3420*~95-98%*Highly conserved
B. thuringiensisBT_3420*~93-96%*Similar genomic context
B. subtilisYhfK*~60-70%*Different genomic neighborhood

*These identifiers and percentages are estimates based on typical conservation patterns between these species and would need verification for this specific protein

Genomic context comparison:

  • Analyze gene neighborhoods across species

  • Identify conserved operon structures

  • Correlate with species-specific physiological traits

How can integrating multi-omics data enhance functional characterization of BA_3420/GBAA_3420/BAS3170?

For challenging uncharacterized proteins, integration of multiple data types provides a more comprehensive picture:

Multi-omics integration strategy:

  • Genomics: Analyze synteny and gene neighborhood

  • Transcriptomics: Identify co-expressed genes under various conditions

  • Proteomics: Map protein-protein interactions and post-translational modifications

  • Metabolomics: Identify metabolic changes in knockout/overexpression strains

  • Phenomics: Catalog phenotypic changes across growth conditions

Integration framework:

  • Weighted network analysis to identify functional modules

  • Machine learning approaches for feature importance ranking

  • Pathway enrichment analysis for functional context

Visualization and analysis:

  • Create integrated network models

  • Develop testable hypotheses based on multi-omics patterns

  • Prioritize validation experiments based on convergent evidence

What are the best practices for storage and handling of recombinant BA_3420/GBAA_3420/BAS3170?

Proper handling is essential for maintaining protein integrity and experimental reproducibility:

Storage recommendations:

  • Store lyophilized protein at -20°C to -80°C

  • Reconstitute at 10 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin

  • After reconstitution, store aliquots at -80°C and avoid repeated freeze-thaw cycles

  • For the carrier-free version (CF), additional stabilizing agents may be necessary

Handling precautions:

  • Work quickly when the protein is thawed

  • Maintain sterile conditions to prevent microbial contamination

  • Use low-binding microcentrifuge tubes to prevent protein loss

Stability considerations:

  • Monitor protein stability via analytical methods (e.g., SDS-PAGE) after storage

  • Document batch-to-batch variation for experimental reproducibility

  • Consider adding protease inhibitors during experimental procedures

How can structure-based predictions inform experimental design for BA_3420/GBAA_3420/BAS3170?

Modern structural prediction tools can guide functional experiments:

Structure prediction approach:

  • Generate models using AlphaFold2 or RoseTTAFold

  • Validate predicted structures using ProQ, VERIFY3D

  • Identify potential functional sites using CASTp, POOL

  • Analyze electrostatic surface for binding regions

  • Perform molecular dynamics simulations to assess flexibility

Structure-guided experimental design:

Structural FeaturePrediction MethodExperimental ValidationExpected Outcome
Predicted binding pocketCASTp, conservation analysisSite-directed mutagenesisAltered binding or catalytic activity
Surface charge clusterAPBS electrostaticsCharge-reversal mutationsChanged interaction properties
Conserved surface patchConSurf analysisAlanine scanningIdentification of functional regions
Dynamic regionsMolecular dynamicsDisulfide engineeringRestricted function if movement is important

By iteratively refining structural models based on experimental results, researchers can efficiently explore the function of this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.