Recombinant UPF0316 protein STH2077 (STH2077)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
STH2077; UPF0316 protein STH2077
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Symbiobacterium thermophilum (strain T / IAM 14863)
Target Names
STH2077
Target Protein Sequence
MRLAKEVEAALDLLIIFLAQATYVSVNTVRWIILVKGRRLLASAISFFEVILWVYALGLV VSQLSDPVKVATYALGYAVGALVGSKIEERLALGYVLFQVITTRIGELAPALREHGLGVT DWRAEGRMGQREVLMVVARRKNGPQVVRLLEELDPQAFVVQLDASWYRGGFIQKMLQ
Uniprot No.

Target Background

Database Links

KEGG: sth:STH2077

STRING: 292459.STH2077

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0316 protein STH2077 and what are its basic properties?

UPF0316 protein STH2077 is a protein from Symbiobacterium thermophilum with UniProt accession number Q67MN1. It consists of 177 amino acids and represents a full-length protein with currently uncharacterized function as indicated by the UPF (Uncharacterized Protein Family) designation . The protein has a distinctive amino acid sequence that suggests potential membrane-associated properties, though detailed structural and functional characterizations remain limited in the current literature.

What are the optimal storage conditions for maintaining STH2077 protein stability?

For optimal stability and activity preservation, recombinant UPF0316 protein STH2077 should be stored according to these research-validated guidelines:

  • Long-term storage: -20°C to -80°C (with -80°C preferred for extended periods)

  • Buffer composition: Typically provided in Tris-based buffer with 50% glycerol

  • Aliquoting: Essential to avoid repeated freeze-thaw cycles which significantly reduce protein integrity

  • Working solution: Store aliquots at 4°C for no more than one week

  • Reconstitution: When using lyophilized preparations, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, then add glycerol (5-50% final concentration) for storage

This storage protocol is specifically designed to minimize structural changes and maintain function while preventing aggregation .

How does the choice of expression system affect the yield and quality of recombinant STH2077?

The selection of an expression system significantly impacts both yield and functional quality of recombinant STH2077. Research demonstrates that E. coli is the predominant host system used for this protein, but expression outcomes vary based on several critical factors:

Expression System ComponentImpact on Protein ProductionOptimization Strategy
Promoter strengthAffects transcription rate and potential metabolic burdenBalance between P T7, Plac trc, P tac, and P BAD promoters based on protein complexity
Replication originDetermines plasmid copy number and expression loadHigh copy (pMB1') vs. low copy (p15A) selection based on protein toxicity
E. coli strainInfluences post-translational processingBL21(DE3) standard strain; ΔackA mutant strains reduce acetate production and may improve yield

What purification strategies are most effective for obtaining high-purity STH2077?

For obtaining research-grade STH2077 preparations, a systematic purification approach is recommended based on the recombinant protein's properties:

  • Primary capture: Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag present in most commercial recombinant versions

  • Buffer optimization: Tris-based buffers (pH 8.0) containing either 6% trehalose or 50% glycerol have been documented to maintain stability during purification

  • Quality assessment: SDS-PAGE analysis to confirm >90% purity as standard for research applications

  • Advanced purification: For specialized structural or interaction studies, secondary purification steps such as size-exclusion chromatography may be necessary

This approach aligns with established protocols for thermophilic proteins while addressing the specific characteristics of STH2077 .

What experimental approaches are most suitable for determining the biological function of STH2077?

Since STH2077 remains functionally uncharacterized, a multi-faceted experimental strategy is recommended:

  • Structural analysis: Techniques like X-ray crystallography or cryo-EM can reveal structural motifs that suggest function. Alternatively, computational structure prediction using tools like AlphaFold2 can provide initial insights.

  • Comparative genomics: Analysis of gene neighborhood in Symbiobacterium thermophilum and identification of homologs in other species can provide functional clues.

  • Interaction studies: Identifying binding partners through techniques such as:

    • Pull-down assays with immobilized STH2077

    • Cross-linking followed by mass spectrometry (XL-MS)

    • Yeast two-hybrid screening against a thermophile protein library

  • Biochemical assays: Based on structural predictions, test for enzymatic activities such as:

    • Nucleic acid binding capacity

    • Potential membrane interactions

    • Catalytic activities using substrate panels

  • Genetic approaches: Generate knockout strains in Symbiobacterium thermophilum to observe phenotypic changes under various growth conditions

This systematic approach addresses the challenges inherent in characterizing proteins of unknown function from thermophilic organisms .

How can researchers assess potential interactions between STH2077 and other cellular components?

To rigorously characterize STH2077 interactions with other cellular components, researchers should employ complementary techniques that address different aspects of potential interactions:

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for low-sample consumption analysis

  • Structural approaches to interaction mapping:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding interfaces

    • NMR spectroscopy for mapping interaction surfaces on smaller binding partners

    • Co-crystallization attempts with potential binding partners

  • Cellular localization studies:

    • Immunolocalization in fixed cells if antibodies are available

    • Recombinant expression with fluorescent tags in model systems

These approaches should be conducted under conditions that respect the thermophilic origin of STH2077, potentially including temperature considerations in experimental design .

What mass spectrometry approaches are most informative for studying STH2077 modifications and interactions?

Mass spectrometry offers multiple advanced approaches for characterizing STH2077:

  • Intact protein analysis: Determination of exact molecular weight and confirmation of full sequence coverage, particularly important for verifying the integrity of recombinant preparations

  • Post-translational modification (PTM) mapping:

    • Bottom-up proteomics with enrichment strategies for specific PTMs

    • Top-down proteomics for comprehensive PTM landscape

    • Targeted mass spectrometry methods for quantification of specific modifications

  • Protein-protein interaction analysis:

    • Chemical cross-linking followed by MS (XL-MS) to determine interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify conformational changes upon binding

    • Affinity purification coupled with MS for identifying interaction networks

  • Quantitative proteomics:

    • SILAC or TMT labeling to study changes in STH2077 abundance or interactions under different conditions

    • Targeted proteomics (PRM/MRM) for absolute quantification in complex samples

These MS-based approaches should be coupled with appropriate bioinformatic analysis workflows for thermophilic proteins to account for potential sequence variations .

How should researchers interpret and address contradictory experimental results when studying STH2077?

When encountering contradictory results in STH2077 research, a systematic troubleshooting approach should be employed:

  • Protein quality assessment:

    • Verify batch-to-batch consistency through analytical methods (SDS-PAGE, mass spectrometry)

    • Assess protein folding and structural integrity (circular dichroism, thermal shift assays)

    • Confirm tag influence by comparing different constructs (N-terminal vs. C-terminal tags)

  • Experimental conditions optimization:

    • Test temperature dependence (room temperature vs. elevated temperatures reflecting thermophilic origin)

    • Evaluate buffer composition effects (salt concentration, pH, additives)

    • Consider time-dependent effects (protein stability over experimental duration)

  • Methodological validation:

    • Apply orthogonal techniques to verify key findings

    • Include proper positive and negative controls

    • Perform statistical analysis to determine significance of observed differences

  • Literature comparison and collaboration:

    • Compare results with studies on related UPF proteins or other Symbiobacterium thermophilum proteins

    • Establish collaborations for independent validation

This structured approach helps distinguish between genuine biological complexity and technical artifacts that might lead to contradictory results .

What bioinformatic tools and databases are most valuable for analyzing STH2077?

For comprehensive in silico analysis of STH2077, researchers should utilize the following resources:

Analysis TypeRecommended Tools/DatabasesApplication to STH2077 Research
Sequence AnalysisUniProt (Q67MN1), BLAST, Clustal OmegaIdentify conserved domains and evolutionary relationships
Structural PredictionAlphaFold2, I-TASSER, SWISS-MODELGenerate 3D structural models to predict functional sites
Functional PredictionInterPro, Pfam, PROSITEIdentify potential functional domains and motifs
Genomic ContextSTRING, MicrobesOnlineExamine gene neighborhood for functional associations
Evolutionary AnalysisMEGA, PhyML, PAMLAnalyze selection pressures and evolutionary rates
Subcellular LocalizationPSORT, SignalP, TMHMMPredict cellular localization and membrane association

These computational resources can generate testable hypotheses about STH2077 function prior to experimental validation, significantly accelerating the research process .

How can structure prediction inform functional studies of STH2077?

Structure prediction serves as a powerful starting point for functional characterization of STH2077 through multiple avenues:

  • Identification of functional motifs: Predicted 3D structures may reveal spatial arrangements of amino acids that form catalytic sites or binding pockets not obvious from sequence alone.

  • Comparative structural analysis: Structural similarity to proteins of known function can suggest potential biochemical activities, even when sequence identity is low.

  • Ligand binding prediction: Computational docking studies can identify potential substrates or binding partners based on the predicted structure.

  • Design of truncation/mutation experiments: Structure prediction can guide the rational design of protein variants to test functional hypotheses.

  • Protein engineering applications: If thermostability features are identified in the structure, these elements could be transferred to other proteins in synthetic biology applications.

The integration of structural predictions with experimental validation represents a powerful approach for deciphering the function of this uncharacterized protein .

How might understanding STH2077 contribute to thermophilic protein engineering?

Research on STH2077 from the thermophilic bacterium Symbiobacterium thermophilum offers significant potential for protein engineering applications:

  • Thermostability mechanisms: Identifying structural features that confer heat resistance to STH2077 could inform the development of thermostable enzymes for industrial applications.

  • Membrane protein design: If STH2077 is confirmed to have membrane-associated properties, its structural adaptations could guide the engineering of stable membrane proteins for biotechnological applications.

  • Scaffold development: The protein could serve as a stable scaffold for designing novel binding interfaces, similar to how designed ankyrin repeat proteins (DARPins) have been developed as antibody alternatives .

  • Extremophile synthetic biology: Characterization of STH2077 could contribute to the growing toolkit for developing synthetic biology applications in extreme environments.

  • Protein folding insights: Understanding how this protein maintains stability at high temperatures could inform broader protein folding research and the development of algorithms to predict protein stability .

What emerging technologies might accelerate functional characterization of proteins like STH2077?

Several cutting-edge technologies hold promise for accelerating the functional characterization of uncharacterized proteins like STH2077:

  • AI-driven structural biology: Beyond AlphaFold2, emerging AI tools that predict protein-protein interactions and dynamic conformational changes could provide functional insights.

  • High-throughput phenotypic screening: Advanced robotic systems coupled with image-based phenotypic analysis can rapidly test multiple conditions to identify functional phenotypes.

  • Single-molecule techniques: Methods like single-molecule FRET and force spectroscopy can reveal dynamic properties and conformational changes that inform function.

  • Cryo-electron tomography: This technique can visualize proteins in their cellular context, potentially revealing associations and localizations that suggest function.

  • Microfluidic enzyme assays: High-throughput microfluidic platforms can test thousands of potential substrates or reaction conditions simultaneously.

  • Deep mutational scanning: Systematic analysis of thousands of protein variants can map sequence-function relationships to identify critical residues.

Integration of these technologies within a coordinated research program would significantly accelerate the functional characterization of STH2077 and similar uncharacterized proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.