Recombinant UPF0353 protein MAP_1207 (MAP_1207)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant UPF0353 protein MAP_1207 (MAP_1207) is a recombinant protein from Mycobacterium paratuberculosis . It is also known as UPF0353 protein MAP_1207 . The full length protein sequence consists of 335 amino acids .

Properties

PropertyValue
Protein NamesRecommended name: UPF0353 protein MAP_1207
Gene NamesOrdered Locus Names: MAP_1207
SpeciesMycobacterium paratuberculosis
Expression Region1-335
Sequence InfoFull length protein
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20℃, for extended storage, conserve at -20℃ or -80℃ . Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .
AA SequenceMSLPFLGPMSLSGFEHSWFFLFLLVVAGLAALYILMQLARQRRmLRFANMELLESVAPKR PSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVmLVIDVSQSMRATDVAPNRMA AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEGI FTALQAIATVGAVIGGGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAASLQELKSVYATLQQQIGY ETIKGDASVGWVRLGALVLALAALTALLINRRLPT

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MAP_1207; UPF0353 protein MAP_1207
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Target Names
MAP_1207
Target Protein Sequence
MSLPFLGPMSLSGFEHSWFFLFLLVVAGLAALYILMQLARQRRMLRFANMELLESVAPKR PSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATDVAPNRMA AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEGI FTALQAIATVGAVIGGGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAASLQELKSVYATLQQQIGY ETIKGDASVGWVRLGALVLALAALTALLINRRLPT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0353 protein MAP_1207 and what are its basic characteristics?

UPF0353 protein MAP_1207 is a protein encoded by the MAP_1207 gene in Mycobacterium paratuberculosis. It is classified as an "uncharacterized protein family" (UPF), specifically UPF0353, indicating that its precise biological function remains to be fully elucidated. The protein consists of 335 amino acids (full-length) and has the UniProt ID Q740Y5 . Analysis of its amino acid sequence suggests it may be a membrane-associated protein, as it contains hydrophobic regions characteristic of transmembrane domains. The protein's sequence begins with "MSLPFLGPMSLSGFEHSWFFLFLLVVAGLAALYILMQ..." and continues through a series of predominantly hydrophobic and charged residues .

How should researchers properly store and reconstitute the recombinant protein?

For optimal stability and activity retention, researchers should store the lyophilized powder form of recombinant UPF0353 protein MAP_1207 at -20°C/-80°C upon receipt . The protein should be aliquoted for multiple use to avoid repeated freeze-thaw cycles, which can lead to protein degradation and loss of activity. Working aliquots can be stored at 4°C for up to one week .

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended by manufacturers)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

What expression system is used for producing recombinant MAP_1207 protein?

The recombinant UPF0353 protein MAP_1207 is expressed in Escherichia coli (E. coli) expression systems . The full-length protein (amino acids 1-335) is typically fused to an N-terminal histidine tag (His-tag), which facilitates purification through affinity chromatography . The purity of commercially available recombinant protein is generally greater than 90% as determined by SDS-PAGE analysis . This expression system is advantageous for producing sufficient quantities of protein for biochemical and structural studies, though researchers should be aware that bacterial expression may lack certain post-translational modifications that might be present in the native mycobacterial protein.

What approaches can researchers use to investigate the potential function of UPF0353 protein MAP_1207?

Given that UPF0353 protein MAP_1207 belongs to an uncharacterized protein family, several complementary approaches can be employed to elucidate its function:

  • Bioinformatic Analysis: Sequence comparison with proteins of known function using tools like BLAST, multiple sequence alignment, and phylogenetic analysis can provide initial insights into potential functions .

  • Structural Prediction and Analysis: Tools like AlphaFold2 or RoseTTAFold can predict the three-dimensional structure, which might reveal structural similarities to proteins with known functions even in the absence of sequence homology.

  • Protein-Protein Interaction Studies: Techniques such as pull-down assays using the His-tagged recombinant protein, yeast two-hybrid screens, or proximity labeling approaches can identify potential binding partners that might suggest functional pathways .

  • Localization Studies: Fluorescently tagged versions of the protein can be used to determine subcellular localization in mycobacterial cells, providing clues about its potential role.

  • Gene Knockout/Knockdown: Creating knockout or knockdown strains in Mycobacterium paratuberculosis and assessing phenotypic changes can reveal the protein's importance in various cellular processes.

  • Comparative Genomics: Analyzing the conservation and genomic context of MAP_1207 across different mycobacterial species can provide evolutionary insights into its function .

What experimental considerations are important when working with membrane-associated proteins like MAP_1207?

The amino acid sequence of UPF0353 protein MAP_1207 suggests it may be a membrane-associated protein, which presents specific challenges:

  • Solubilization Optimization: Researchers should test various detergents (such as n-dodecyl-β-D-maltoside, CHAPS, or digitonin) at different concentrations to identify optimal conditions for extracting and maintaining the protein in solution without denaturing it.

  • Buffer Composition: Beyond detergents, buffer components including salt concentration, pH, and additives like glycerol can significantly affect membrane protein stability. A systematic screen of buffer conditions is recommended:

Buffer ComponentRange to TestNotes
pH6.5-8.5Test in 0.5 unit increments
NaCl100-500 mMHigher salt may help reduce non-specific interactions
Glycerol5-20%Acts as a stabilizer
Reducing agents1-5 mM DTT or 5-10 mM β-mercaptoethanolMay be necessary if the protein contains cysteines
DetergentVariableConcentration typically 2-3× the critical micelle concentration
  • Alternative Reconstitution Systems: For functional studies, reconstitution into proteoliposomes, nanodiscs, or amphipols may better mimic the native membrane environment than detergent micelles alone.

  • Temperature Sensitivity: Membrane proteins often show enhanced temperature sensitivity; performing experiments at lower temperatures (4-16°C) may improve stability .

  • Purification Strategy: Two-step purification protocols combining affinity chromatography (utilizing the His-tag) followed by size exclusion chromatography often yield higher purity membrane proteins with better homogeneity.

How might researchers approach studying potential roles of MAP_1207 in Mycobacterium paratuberculosis pathogenesis?

Mycobacterium paratuberculosis is the causative agent of Johne's disease in ruminants and has been associated with Crohn's disease in humans. Investigating the role of MAP_1207 in pathogenesis could include:

  • Expression Analysis: Quantifying expression levels of MAP_1207 under various conditions relevant to infection (hypoxia, nutrient limitation, acidic pH, etc.) using RT-qPCR or proteomics approaches.

  • Infection Models: Comparing the ability of wild-type and MAP_1207 knockout/knockdown strains to infect and persist in cell culture models (macrophages) or animal models.

  • Host Response Analysis: Examining host immune responses to recombinant MAP_1207 protein, including cytokine production profiles and pattern recognition receptor activation.

  • Comparative Studies: Analyzing the presence/absence and sequence conservation of MAP_1207 orthologs among pathogenic and non-pathogenic mycobacteria to determine if it represents a potential virulence factor.

  • Vaccine Potential: Evaluating the immunogenicity of recombinant MAP_1207 and its potential as a vaccine candidate or diagnostic marker.

What analytical techniques are recommended for characterizing the structural properties of recombinant MAP_1207?

To comprehensively characterize the structural properties of recombinant UPF0353 protein MAP_1207, researchers should consider a multi-technique approach:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content (α-helices, β-sheets) and can monitor structural changes under different conditions.

  • Fourier-Transform Infrared Spectroscopy (FTIR): Particularly useful for membrane proteins, providing complementary secondary structure information to CD.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines the oligomeric state and homogeneity of the purified protein.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For detailed structural information if the protein is amenable (not too large).

  • X-ray Crystallography: If the protein can be crystallized, provides high-resolution structural information.

  • Cryo-Electron Microscopy: Increasingly used for membrane proteins that resist crystallization.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Provides information about protein dynamics and solvent accessibility.

TechniqueInformation ProvidedSample RequirementsLimitations
CD SpectroscopySecondary structure estimation0.1-0.5 mg/mL, 200-300 μLLimited by detergent absorption
SEC-MALSMolecular weight, oligomeric state1-2 mg totalRequires homogeneous sample
X-ray CrystallographyHigh-resolution structure5-10 mg/mL, several mLRequires crystals
Cryo-EMMedium to high-resolution structure0.5-5 mg/mL, 3-5 μL per gridSample must be stable in thin ice
HDX-MSDynamics, conformational changes0.5-1 mg/mL, 50-100 μLCompatible MS/peptide coverage

What quality control measures should be implemented when working with recombinant MAP_1207?

Ensuring the quality and integrity of recombinant UPF0353 protein MAP_1207 is critical for experimental reproducibility. Recommended quality control measures include:

  • Purity Assessment: SDS-PAGE analysis followed by Coomassie staining or silver staining to verify >90% purity . Western blotting using anti-His antibodies can confirm the presence of the tagged protein.

  • Mass Spectrometry Verification: Peptide mass fingerprinting or intact mass analysis to confirm protein identity and detect any modifications or truncations.

  • Endotoxin Testing: If the protein will be used in immunological studies, testing for endotoxin contamination using the Limulus Amebocyte Lysate (LAL) assay is essential, as E. coli-derived proteins may contain lipopolysaccharide.

  • Aggregation Analysis: Dynamic light scattering (DLS) or analytical ultracentrifugation (AUC) to assess protein homogeneity and detect aggregation.

  • Stability Assessment: Monitoring protein stability over time using techniques like differential scanning fluorimetry (DSF) to identify optimal buffer conditions.

  • Functional Assays: Where possible, activity assays should be developed to confirm the protein retains its biological function.

How can researchers optimize experimental conditions for studying protein-protein interactions involving MAP_1207?

When investigating potential interaction partners of UPF0353 protein MAP_1207, researchers should consider:

  • Pull-down Assay Optimization:

    • Use the His-tagged recombinant protein as bait with mycobacterial lysates

    • Include appropriate controls (unrelated His-tagged protein, beads-only)

    • Optimize washing conditions to reduce non-specific binding

    • Consider crosslinking approaches for transient interactions

  • Co-immunoprecipitation (Co-IP):

    • Generate specific antibodies against MAP_1207 if available

    • Use mild detergents to preserve protein-protein interactions

    • Validate interactions with reciprocal Co-IPs

  • Yeast Two-Hybrid (Y2H) Screening:

    • Consider membrane-specific Y2H systems if MAP_1207 is membrane-associated

    • Create domain-specific constructs if full-length protein causes technical issues

    • Validate positive interactions using orthogonal methods

  • Proximity-based Approaches:

    • BioID or TurboID fusions to identify proximal proteins in mycobacterial systems

    • APEX2 fusions for proximity labeling in spatially restricted environments

  • Surface Plasmon Resonance (SPR) or Biolayer Interferometry (BLI):

    • For quantitative measurement of binding kinetics with purified candidate interactors

    • Optimize immobilization strategy to maintain protein orientation and activity

What considerations are important for developing antibodies against MAP_1207?

For researchers interested in generating antibodies against UPF0353 protein MAP_1207:

  • Epitope Selection:

    • Analyze the protein sequence for potentially immunogenic regions

    • Select hydrophilic, surface-exposed regions

    • Avoid transmembrane domains which may be poorly immunogenic

    • Consider multiple peptides from different regions of the protein

  • Immunization Strategy:

    • Use full-length recombinant protein for polyclonal antibody production

    • For monoclonal antibodies, consider using both the full-length protein and selected peptides

    • Include proper adjuvants to enhance immunogenicity

  • Antibody Validation:

    • Test specificity against recombinant protein

    • Validate using Western blotting against Mycobacterium paratuberculosis lysates

    • Include knockout/knockdown controls if available

    • Test cross-reactivity with related mycobacterial species

  • Application-specific Considerations:

    • For immunoprecipitation, test under native conditions

    • For immunohistochemistry, verify epitope accessibility in fixed samples

    • For flow cytometry, ensure antibodies recognize native conformations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.