Recombinant Mycobacterium paratuberculosis UPF0353 protein MAP_3434 (MAP_3434)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Mycobacterium paratuberculosis UPF0353 protein MAP_3434 (MAP_3434) is a protein expressed in Mycobacterium paratuberculosis . It is also known as UPF0353 protein MAP_3434 and has a UniProt ID of Q73UD4 .

Table 1: General Information of MAP_3434

PropertyDescription
SynonymsMAP_3434; UPF0353 protein MAP_3434
UniProt IDQ73UD4
SpeciesMycobacterium paratuberculosis

Properties

Recombinant MAP_3434 is produced in E. coli or Yeast expression system as a full-length protein or a protein fragment with a His-tag . It has greater than 85% or 90% purity as determined by SDS-PAGE. The protein is usually stored in Tris/PBS-based buffer with trehalose at -20°C/-80°C .

Table 2: Properties of Recombinant MAP_3434

PropertyDescription
SourceE. coli, Yeast
TagHis
Protein LengthFull Length (1-330)
PurityGreater than 85% or 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Function and Research

MAP_3434 is a protein of Mycobacterium paratuberculosis (MAP), the causative agent of Johne's Disease, a chronic granulomatous enteritis of ruminants . Studies suggest that recombinant MAP proteins, including MAP_3434, can be used as a vaccine to reduce tissue colonization of MAP .
Research has also focused on other proteins of MAP, such as Mce (mammalian cell entry) proteins, to understand the bacterium's interaction with the host . Mce proteins enable Mycobacterial species to attach to and invade host epithelial cells .
Additionally, multi-epitope vaccines targeting MAP have been designed using bioinformatics approaches, offering innovative strategies for creating effective vaccines . These vaccines stimulate immune responses and counter MAP's immune evasion mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MAP_3434; UPF0353 protein MAP_3434
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Mycobacterium paratuberculosis
Target Names
MAP_3434
Target Protein Sequence
MGVVSLPGIGPLPLYGFQRPGMLLFGLVPLALLALYLVVQARRRRRLHRYTDAPVAQSPW RHLPIAVSLLSLVLLTIALATPTHDMRIPRNRAVIMLVIDMSQSMRATDVEPNRLKAAEQ AASQFASQLTPGINLGLVGFAGTPYLLVPPTPQHQATIDALKKLDFADSTATGEAIFTAL HAISATAVAGGDTPPPARIVLLSDGGENKPSNPSDPHDGVYTAARLAKDEGVPISTITFG TKGGEIEMDGQKVAVPVSTDQMKMVAKLSGGQSYTATNLGELQKSYNAIENEIGYRTVPG PGSAGWLRLGVLTALIATALALLINRRLPT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the conservation pattern of MAP_3434 compare across mycobacterial species?

MAP_3434 shows significant conservation among mycobacterial species, particularly within the Mycobacterium avium complex. Comparative genomic analyses have revealed that regions within MAP_3434 are highly conserved, suggesting functional importance. In studies examining genetic diversity and uniqueness of MAP, this protein has been identified among over 30 proteins encoded within unique genetic regions known as large sequence polymorphisms (LSPs) .

When analyzing potential cross-reactivity in immunological studies, researchers should consider the degree of homology between MAP_3434 and proteins from related mycobacteria. Studies have shown variability in cross-reactivity with M. avium subsp. avium proteins that was higher than with the more distantly related M. bovis proteins . This conservation pattern makes MAP_3434 a candidate of interest for both diagnostic applications and for understanding the evolution of pathogenicity in mycobacteria .

What expression systems are most effective for producing recombinant MAP_3434 protein?

Two primary expression systems have been successfully employed for producing recombinant MAP_3434:

Expression SystemTagProtein LengthPurityYieldAdvantagesLimitations
YeastN-terminal 6xHisPartial (91-292aa)>85% by SDS-PAGEVariable (0.54 mg/L reported)Post-translational modifications, proper foldingLower yield, partial protein
E. coliN-terminal 6xHisFull length (1-330aa)>90% by SDS-PAGEVariableHigher yield, complete sequencePotential improper folding, lacks PTMs

For structural studies requiring native-like protein, the yeast expression system may be preferable despite lower yields. For antibody production or interaction studies where higher quantities are needed, the E. coli system typically provides better yields of the full-length protein. When expressing in E. coli, researchers commonly use vectors such as pMAL-c2 to create fusion proteins with maltose-binding protein (MBP) to improve solubility, as demonstrated in comprehensive mycobacterial protein studies .

For quality control, all expression constructs should be sequence-verified to confirm that the cloned insert matches the native MAP_3434 gene and is in-frame with expression signals. Additionally, recombinant proteins should be evaluated by SDS-PAGE to assess purity and ensure migration at the expected molecular weight .

What purification protocols yield the highest purity MAP_3434 protein suitable for functional studies?

Optimal purification of recombinant MAP_3434 protein requires a multi-step approach depending on the expression system and intended application. Based on published protocols, the following purification strategy is recommended:

  • Initial Capture: For His-tagged variants, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with a step gradient of imidazole (20-250 mM) effectively captures the target protein.

  • Intermediate Purification: Size exclusion chromatography using a Superdex 75 or 200 column effectively separates the target protein from contaminating proteins of different molecular weights.

  • Polishing Step: For highest purity (>95%), ion exchange chromatography can be employed as a final step.

The buffer composition significantly impacts protein stability and function. For MAP_3434, optimal storage buffer conditions include:

  • Liquid form: Tris/PBS-based buffer with 5-50% glycerol at pH 7.4-8.0

  • Lyophilized form: Pre-lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

For functional studies, researchers should perform quality assessment using analytical SEC to confirm monomeric state and circular dichroism to verify proper folding. Researchers working with MAP_3434 should note that repeated freeze-thaw cycles significantly reduce protein activity, so aliquoting and storing at -80°C is strongly recommended .

How can MAP_3434 be utilized in developing diagnostic tools for Johne's disease?

MAP_3434 represents a promising candidate for developing improved diagnostic tools for Johne's disease based on several key characteristics:

  • Specificity: As part of studies evaluating mycobacterial antigens, MAP_3434 has demonstrated potential specificity for Mycobacterium avium subsp. paratuberculosis. In protein arrays containing 93 recombinant MAP proteins tested against sera from infected cattle, membrane proteins including MAP_3434 showed reactivity patterns that could distinguish MAP infection from other mycobacterial infections .

  • Diagnostic Applications: Current diagnostic tests for Johne's disease rely on complex, ill-defined mixtures of proteins such as whole-cell sonicated extracts or purified protein derivatives that show variability in potency and cross-react with closely related mycobacteria . Recombinant MAP_3434, as part of a defined antigen panel, could potentially improve specificity in:

    • ELISA-based serological assays

    • Immunoblot assays

    • Gamma interferon (IFN-γ) release assays

  • Antigen Combinations: Research suggests that using MAP_3434 in combination with other recombinant MAP proteins (such as MAP1204, MAP1730c, and MAP2121c) in a cocktail approach may yield higher sensitivity and specificity than single-antigen tests .

When developing diagnostic applications, researchers should consider combining MAP_3434 with other antigens identified in comprehensive screening studies. A study evaluating 54 recombinant proteins identified seven promising antigens (MAP2513, MAP1693, MAP2020, MAP0038, MAP1272, MAP0209c, and MAP0210c) that showed good reactivity with sera from animals with paratuberculosis while exhibiting minimal cross-reactivity with sera from healthy animals or those infected with M. bovis . Similar approaches could incorporate MAP_3434 for enhanced diagnostic performance.

What is known about MAP_3434's role in the pathogenesis of Mycobacterium paratuberculosis infection?

The precise role of MAP_3434 in the pathogenesis of Mycobacterium paratuberculosis infection remains under investigation, but several lines of evidence suggest potential functional significance:

For researchers studying MAP_3434's role in pathogenesis, experimental approaches could include:

  • Gene knockout or knockdown studies to assess virulence in cellular or animal models

  • Protein-protein interaction studies to identify host binding partners

  • Structural analysis to identify potential functional domains

  • Comparative analyses with homologous proteins in other mycobacterial species

What are the optimal storage conditions and stability parameters for MAP_3434 protein?

Proper storage of recombinant MAP_3434 protein is critical for maintaining its structural integrity and functional activity. Based on experimental data, the following storage conditions are recommended:

FormStorage ConditionsBuffer CompositionStability PeriodSpecial Considerations
Liquid−20°C to −80°CTris/PBS-based buffer with 5-50% glycerol, pH 8.0Up to 6 monthsAliquot to avoid freeze-thaw cycles
Lyophilized−20°C to −80°CPre-lyophilization in Tris/PBS-based buffer with 6% Trehalose, pH 8.0Up to 12 monthsReconstitute in deionized sterile water
Working aliquots4°COriginal bufferUp to one weekAvoid repeated freeze-thaw cycles

When reconstituting lyophilized protein, it is recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute to a concentration of 0.1-1.0 mg/mL in deionized sterile water. For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (with 50% being optimal) and aliquot before storing at −20°C/−80°C .

Stability studies have shown that MAP_3434 is particularly sensitive to repeated freeze-thaw cycles, which can lead to aggregation and loss of activity. Research indicates that protein activity decreases significantly after 3-4 freeze-thaw cycles, making aliquoting essential for experiments requiring multiple uses of the same protein preparation .

How can researchers design experiments to assess MAP_3434 interactions with host cell components?

Designing robust experiments to investigate MAP_3434 interactions with host cell components requires multiple complementary approaches:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP): Using antibodies against MAP_3434 to pull down potential binding partners from host cell lysates, followed by mass spectrometry identification.

    • Yeast Two-Hybrid Screening: For identifying direct protein-protein interactions between MAP_3434 and host proteins.

    • Proximity Labeling: BioID or APEX2 fusions with MAP_3434 to identify proximal proteins in cellular contexts.

  • Binding Assays:

    • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between purified MAP_3434 and candidate host proteins.

    • ELISA-based Binding Assays: To screen interactions with extracellular matrix components such as fibronectin, laminin, or collagen.

    • Cell Binding Assays: Using fluorescently labeled MAP_3434 to visualize binding to host cell surfaces.

  • Functional Impact Assessment:

    • Invasion Assays: Comparing wild-type bacteria with MAP_3434 knockouts or evaluating the impact of recombinant MAP_3434 on bacterial invasion of bovine epithelial cells.

    • Signaling Studies: Monitoring changes in host cell signaling pathways (such as MAPK or NF-κB activation) upon exposure to MAP_3434.

    • Cytokine Production: Measuring cytokine release from host cells exposed to MAP_3434.

When designing these experiments, researchers should incorporate appropriate controls including:

  • Unrelated mycobacterial proteins of similar size and cellular localization

  • Heat-denatured MAP_3434 to control for non-specific binding

  • Competitive inhibition with antibodies against MAP_3434

  • Dose-response relationships to establish specificity

Based on studies of other MAP proteins, potential host interaction partners to investigate include fibronectin, laminin, and cellular receptors that mediate bacterial invasion . For example, the MAP laminin-binding/histone-like protein (Lbp/Hlp) has been shown to react with sera from patients with Crohn's disease, and other MAP proteins facilitate entry into bovine epithelial cells through specific interactions with host receptors .

How can contradictions in MAP_3434 experimental data be resolved through improved experimental design?

Researchers working with MAP_3434 may encounter contradictory experimental results due to several factors. Systematic approaches to resolving these contradictions include:

When contradictions appear between different research groups' findings, collaborative cross-validation studies using standardized materials and protocols represent the most robust approach to resolution. This strategy has been successfully employed in other mycobacterial research contexts to resolve discrepancies in protein function .

What structural and functional analyses can reveal about MAP_3434's potential enzymatic activities?

Advanced structural and functional analyses can provide insights into MAP_3434's potential enzymatic activities, despite its current classification as a protein of unknown function (UPF0353 family). Recommended approaches include:

  • Structural Characterization:

    • X-ray Crystallography/Cryo-EM: Determining the three-dimensional structure can reveal structural motifs associated with known enzymatic functions. For membrane-associated proteins like MAP_3434, crystallization in the presence of detergents or lipid nanodiscs may be necessary.

    • NMR Spectroscopy: For analyzing dynamics and identifying potential catalytic residues through chemical shift perturbations upon substrate binding.

    • Computational Structure Prediction: Using AlphaFold2 or similar tools to predict structure and compare with known enzyme folds.

  • Functional Domain Analysis:

    • Conserved Domain Search: Detailed bioinformatic analysis of the MAP_3434 sequence reveals that while classified as UPF0353, it may contain cryptic domains with homology to known enzymatic families.

    • Site-Directed Mutagenesis: Systematically mutating conserved residues can help identify those critical for potential enzymatic activity.

    • Substrate Screening: High-throughput screens against libraries of potential substrates (metabolites, peptides, lipids) can identify unexpected enzymatic activities.

  • Comparative Genomic Approaches:

    • Genomic Context Analysis: Examining genes adjacent to MAP_3434 in the MAP genome may provide clues about function based on operonic organization.

    • Phylogenetic Profiling: Identifying co-evolution patterns with proteins of known function can suggest functional relationships.

    • Expression Correlation Analysis: Analyzing co-expression patterns with genes of known function may indicate participation in specific pathways.

  • Biochemical Assays Based on Structural Predictions:

    • Based on structural features, targeted assays can be developed to test specific enzymatic activities:

      • Hydrolase activity (esterase, peptidase)

      • Oxidoreductase activity

      • Transferase activity

      • Membrane transport function

Given that many mycobacterial proteins have evolved unique functions despite structural similarity to known enzyme families, researchers should consider testing MAP_3434 for multiple potential activities rather than limiting investigations based on sequence homology alone. For example, the MAP3464 gene encodes an oxidoreductase involved in invasion of bovine epithelial cells through the activation of host cell Cdc42, a function that would not have been predicted by sequence analysis alone .

How does MAP_3434 compare with other mycobacterial membrane proteins in host-pathogen interaction studies?

Comparative analysis of MAP_3434 with other well-characterized mycobacterial membrane proteins provides valuable context for understanding its potential role in host-pathogen interactions:

Mycobacterial ProteinOrganismFunctional RoleHost TargetsResearch ApplicationsSimilarity to MAP_3434
MAP3464M. avium subsp. paratuberculosisOxidoreductase involved in epithelial cell invasionHost cell Cdc42Invasion assays, signaling studiesMembrane association, potential role in invasion
Fibronectin Attachment Protein (FAP)M. avium subsp. paratuberculosisMediates fibronectin bindingFibronectinAdhesion assays, blocking studiesPotential ECM binding activity
Laminin-binding/histone-like protein (Lbp/Hlp)M. avium subsp. paratuberculosisBinds lamininLamininCrohn's disease association studiesPotential cross-reactivity with human proteins
MAP1204M. avium subsp. paratuberculosisPutative invasin with Nlpc_P60 domainUnknownDiagnostic applicationsSimilar diagnostic potential
MAP1730cM. avium subsp. paratuberculosisPutative GTPaseUnknownAntibody detection, diagnosticsRecognized by sera from infected animals

Researchers investigating MAP_3434 should consider experimental designs that have successfully elucidated functions of other mycobacterial membrane proteins:

  • Cell Entry Studies: Examining whether recombinant MAP_3434 can facilitate entry of non-invasive bacteria into epithelial cells or inhibit entry of wild-type MAP, similar to studies with MAP3464 .

  • Extracellular Matrix Binding: Testing MAP_3434's ability to bind components of the extracellular matrix, as demonstrated for the Fibronectin Attachment Protein .

  • Host Response Modulation: Investigating whether MAP_3434 alters cytokine production or signaling pathways in host cells, as has been shown for other mycobacterial membrane proteins that influence interleukin-1β release and macrophage transepithelial migration .

By building on established protocols for studying mycobacterial membrane proteins, researchers can systematically investigate MAP_3434's specific contributions to MAP pathogenesis.

What methodological approaches can determine MAP_3434's potential role in Mycobacterium paratuberculosis virulence and persistence?

Determining MAP_3434's role in virulence and persistence requires multi-faceted approaches combining molecular genetics, cellular microbiology, and in vivo models:

  • Genetic Manipulation Strategies:

    • Gene Knockout/Knockdown: Creating MAP_3434 deletion mutants using specialized transduction or CRISPR-based techniques adapted for mycobacteria. Challenges include the slow growth of MAP and potentially essential nature of the gene.

    • Conditional Expression Systems: Implementing tetracycline-inducible or similar systems to control MAP_3434 expression levels during different infection stages.

    • Site-Directed Mutagenesis: Creating point mutations in conserved residues to identify domains critical for virulence while maintaining protein expression.

  • In Vitro Infection Models:

    • Macrophage Survival Assays: Comparing wild-type and MAP_3434-modified strains for survival within bovine macrophages over extended periods (up to 72 hours).

    • Epithelial Cell Invasion Assays: Quantifying invasion efficiency of intestinal epithelial cells, focusing on differences in initial attachment versus intracellular replication.

    • Biofilm Formation: Assessing the contribution of MAP_3434 to biofilm development, which may contribute to environmental persistence.

  • Ex Vivo Tissue Models:

    • Intestinal Organoids: Using bovine intestinal organoids to mimic the complex cellular environment encountered during natural infection.

    • Tissue Explant Studies: Working with explanted bovine intestinal tissue to assess bacterial translocation and early host responses.

  • In Vivo Experimental Approaches:

    • Animal Infection Models: Utilizing goat or mouse models of paratuberculosis to compare colonization, persistence, and pathology between wild-type and MAP_3434-modified strains.

    • Competitive Index Assays: Co-infecting animals with wild-type and mutant strains to directly compare fitness in vivo.

    • Time-Course Studies: Sampling infected tissues at multiple timepoints to determine whether MAP_3434 is particularly important in specific infection stages.

  • Host Response Analyses:

    • Transcriptomics: RNA-seq analysis of host cells infected with wild-type versus MAP_3434-modified strains to identify differentially regulated pathways.

    • Immunological Profiling: Characterizing differences in cytokine production, immune cell recruitment, and adaptive immune responses.

    • Metabolomics: Identifying metabolic changes in host cells that may contribute to bacterial persistence.

By integrating these methodological approaches, researchers can comprehensively assess MAP_3434's contribution to virulence and persistence. Given the challenges of working with slow-growing mycobacteria, complementary approaches using recombinant protein to block potential functions can provide more rapid insights while genetic systems are being established.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.