Recombinant UPF0353 protein MAP_3435c (MAP_3435c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on standard blue ice. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize your request during development.
Synonyms
MAP_3435c; UPF0353 protein MAP_3435c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Target Names
MAP_3435c
Target Protein Sequence
MKLPLLGPVSVTGFQNPWFFLALLAVLLVIGLYVVQQFARRRRVLRFANMEVLERVAPPH PSRWRHVPTILLATSLVLLTTAMAGPTSDVRIPLNRAVVMLVIDVSESMASTDVPPNRLA AAKEAGKQFADQLTPAINLGLVEFAANATLLVPPTTNRAAVKAGIDSLQPAPKTATGEGI FTALQAIATVGSVMGGGEGPPPARIVLESDGAENVPLDPNAPQGAFTAARAAKAEGVQIS TISFGTPYGTVDYEGATIPVPVDDQTLQKICEITDGQAFHADSLDSLKNVYSTLQRQIGY ETVKGDASMAWMLLGAVVLAGAVLAGLLLNRRLPA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0353 protein MAP_3435c and what are its basic characteristics?

UPF0353 protein MAP_3435c is a full-length protein (335 amino acids) derived from Mycobacterium Paratuberculosis. It has the UniProt ID Q73UD3 and is also known by its synonym "UPF0353 protein MAP_3435c" . The protein is typically expressed as a recombinant form with an N-terminal His-tag in E. coli expression systems for research applications . Based on its amino acid sequence, the protein appears to have hydrophobic regions that may indicate membrane association, which is an important consideration for experimental design.

What are the optimal storage conditions for recombinant MAP_3435c?

The recombinant MAP_3435c protein should be stored according to these research-validated guidelines:

Storage PeriodRecommended ConditionsNotes
Long-term-20°C to -80°CAliquoting necessary for multiple use
Working solutions4°CFor up to one week only
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability

Researchers should avoid repeated freeze-thaw cycles, as this can significantly compromise protein integrity . For experimental reproducibility, it is advisable to use fresh aliquots when possible and maintain detailed records of storage conditions and freeze-thaw history.

What is the recommended reconstitution protocol for lyophilized MAP_3435c?

For optimal experimental results, follow this detailed reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Prepare small aliquots to minimize freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

This protocol helps maintain protein stability and activity. The addition of glycerol serves as a cryoprotectant to prevent damage during freezing and thawing processes, which is particularly important for membrane-associated proteins like MAP_3435c.

How can researchers overcome expression challenges for full-length MAP_3435c?

Expression of full-length proteins like MAP_3435c presents several challenges that researchers should address systematically:

  • Hydrophobicity management: The amino acid sequence of MAP_3435c contains hydrophobic regions that may cause folding issues during expression . Consider using specialized E. coli strains designed for membrane proteins or fusion partners that enhance solubility.

  • Codon optimization: Analyze the sequence for rare codons that might impede efficient translation in E. coli. Codon optimization or the use of strains supplemented with rare tRNAs can significantly improve expression yields .

  • Toxicity mitigation: If the protein exhibits toxicity to the expression host, consider using tightly regulated inducible systems or lower expression temperatures (16-25°C) to reduce metabolic burden and improve proper folding .

  • Translation initiation optimization: To prevent truncated products, carefully design the N-terminal sequence and consider using dual-tagged constructs (N and C-terminal tags) to facilitate identification and purification of full-length protein .

What analytical methods are recommended for verifying MAP_3435c purity and integrity?

For rigorous quality control of recombinant MAP_3435c, implement these analytical methods:

  • SDS-PAGE analysis: The recombinant protein should demonstrate >90% purity as determined by SDS-PAGE . Use 10-12% gels for optimal resolution of the 335 amino acid protein.

  • Western blotting: Utilize anti-His antibodies to confirm the presence of the N-terminal His-tag, verifying expression of the complete recombinant construct.

  • Mass spectrometry: Perform peptide mass fingerprinting to verify protein identity and sequence coverage, particularly important for detecting any truncations or modifications.

  • Size-exclusion chromatography: Assess protein homogeneity and detect any aggregation or oligomerization states that might affect experimental outcomes.

  • Dynamic light scattering: Evaluate the polydispersity of the protein sample, which is particularly relevant for membrane-associated proteins that may form micelles or other structures in solution.

What structural analysis approaches are most suitable for MAP_3435c characterization?

Considering the membrane-associated nature of MAP_3435c, researchers should consider these specialized structural analysis approaches:

  • Circular dichroism (CD) spectroscopy: To analyze secondary structure content and fold integrity in various detergent or lipid environments.

  • Nuclear magnetic resonance (NMR) spectroscopy: For studying protein dynamics and structural elements in a native-like membrane environment, particularly useful for determining localized structural features.

  • Cryo-electron microscopy: Given the challenges in crystallizing membrane proteins, cryo-EM represents a viable alternative for structural determination, especially if MAP_3435c forms part of a larger complex.

  • Molecular dynamics simulations: Computational approaches can provide insights into protein behavior within membranes and guide experimental design. The complete amino acid sequence available for MAP_3435c facilitates such in silico analyses .

  • Limited proteolysis coupled with mass spectrometry: To identify stable domains and flexible regions, informing construct design for structural studies.

How can researchers investigate potential interaction partners of MAP_3435c?

To elucidate the functional network of MAP_3435c, consider these methodological approaches:

  • Affinity purification with MS identification: Utilize the His-tag for pull-down experiments followed by mass spectrometry to identify co-purifying proteins from mycobacterial lysates.

  • Bacterial two-hybrid systems: Adapted for membrane proteins, these systems can identify protein-protein interactions in a cellular context.

  • Proximity labeling methods: Techniques such as BioID or APEX2 fused to MAP_3435c can identify proteins in close proximity within the native cellular environment.

  • Co-immunoprecipitation studies: Similar to approaches used in other recombinant protein studies, researchers can use co-IP to confirm specific interactions identified through screening methods .

  • Computational prediction and validation: Leverage structural information and bioinformatic tools to predict potential interaction partners based on complementary domains or surfaces, followed by targeted experimental validation.

What considerations are important when designing functional assays for MAP_3435c?

When designing functional assays for MAP_3435c, researchers should consider:

  • Membrane environment reconstitution: Since MAP_3435c appears to be membrane-associated, functional assays should include appropriate lipid environments that mimic the native mycobacterial membrane composition.

  • Buffer optimization: Test various buffer conditions including pH ranges and salt concentrations to identify optimal conditions for preserving protein function.

  • Protein orientation considerations: For transmembrane proteins, the orientation in artificial membrane systems (liposomes, nanodiscs) is crucial for proper function and interaction studies.

  • Detergent selection: If detergents are necessary, screen multiple options to identify those that maintain protein structure and function while providing sufficient solubilization.

  • Tag interference assessment: Evaluate whether the N-terminal His-tag affects protein function through control experiments comparing the behavior of tagged versus untagged protein versions.

What are common technical challenges when working with MAP_3435c and how can they be addressed?

ChallengePotential CausesRecommended Solutions
Low expression yieldsProtein toxicity, hydrophobicityUse lower induction temperatures (16-20°C); optimize codon usage; consider fusion partners
Protein aggregationImproper folding, hydrophobic interactionsScreen detergents; add stabilizing agents; optimize purification conditions
Loss of activity after purificationDenaturation during purification stepsInclude stabilizing agents; minimize exposure to harsh conditions; validate structural integrity
Inconsistent experimental resultsBatch-to-batch variabilityImplement rigorous quality control; prepare larger, homogeneous batches; standardize protocols
Difficulty in structural characterizationMembrane protein propertiesConsider specialized techniques for membrane proteins; use computational predictions to guide experiments

Researchers should document troubleshooting efforts systematically to build a knowledge base for work with MAP_3435c .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.