Recombinant UPF0353 protein MAV335

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant UPF0353 Protein MAV335

Recombinant proteins are essential tools used to investigate biological interactions in a research laboratory . A recombinant protein is a protein that is produced from recombinant DNA. This means that the DNA encoding the protein has been cloned into an expression vector and introduced into a host cell, such as E. coli, yeast, insect, or mammalian cells. The host cell then produces the protein based on the instructions in the recombinant DNA .

UPF0353 protein MAV335 is a protein that, when produced recombinantly, can be used in various applications, including as an antigen, in cell assays, binding assays or protein-protein interaction studies, cell culture serum-free medium, drug-related studies, enzymatic activity assays in vitro, ELISA as a standard and its raw materials, in vivo studies, mass spectrometry as a standard, protein chip applications, SDS-PAGE control, and protein structure analysis such as crystal or electron microscopy .

Applications of Recombinant Proteins

Recombinant UPF0353 protein MAV335, like other recombinant proteins, can be utilized across a spectrum of applications :

  • Antigen: Recombinant proteins can be used as antigens to generate antibodies .

  • Cell Assay: These proteins can be employed in cell-based assays to study their effects on cellular functions .

  • Binding Assay/Protein-Protein Interaction: Recombinant proteins facilitate the study of protein interactions .

  • Cell Culture-Serum-Free Medium: They can be used in serum-free cell culture media .

  • Drug Related Studies: Recombinant proteins play a crucial role in drug development and research .

  • Enzymatic Activity In Vitro: They are used to measure enzymatic activity in controlled laboratory settings .

  • ELISA Standard and Its Raw Materials: Recombinant proteins serve as standards in ELISA assays .

  • In Vivo Study: They are utilized in in vivo studies to understand their effects in living organisms .

  • Mass Spectrometry Standard: Recombinant proteins can be used as standards in mass spectrometry .

  • Protein Chip: They are applied in protein chip technology for high-throughput analysis .

  • SDS-PAGE Control: These proteins are used as controls in SDS-PAGE electrophoresis .

  • Protein Structure Analysis (Crystal/Electron Microscope): Recombinant proteins are used in determining protein structures .

Advantages of Using Recombinant Proteins

The use of recombinant proteins like UPF0353 offers several advantages:

  • Purity: Recombinant proteins can be produced with high purity, which is essential for many applications.

  • Availability: Recombinant technology allows for the production of proteins that are otherwise difficult to obtain in sufficient quantities.

  • Controlled Production: The production process can be tightly controlled to ensure consistency and reproducibility.

  • Modification: Recombinant proteins can be modified to include tags (such as His, GST, Flag, or MBP) for purification or detection .

Expression Systems for Recombinant Proteins

Recombinant UPF0353 protein MAV335 can be expressed in various systems, each with its own advantages :

  • E. coli: A common and cost-effective system for producing many proteins.

  • Yeast: Suitable for producing proteins that require post-translational modifications.

  • Baculovirus-Infected Insect Cells: Useful for expressing large and complex proteins.

  • Mammalian Cells: Ideal for proteins that require specific mammalian post-translational modifications.

  • In Vitro E. coli: A unique expression system that omits several processes, improving working efficiency .

Case Study: gAdiponectin/gAcrp30 as a Model Recombinant Protein

While specific research findings for Recombinant UPF0353 protein MAV335 are not available in the provided context, examining similar recombinant proteins can offer insights. For example, recombinant mouse gAdiponectin/gAcrp30 protein is used in studies related to metabolism and inflammation .

5.1. Background of gAdiponectin/gAcrp30

Adiponectin, also known as Adipocyte Complement-Related Protein of 30 kDa (Acrp30), is a protein with structural similarities to complement factor C1q . It is secreted by adipocytes and has a modular structure consisting of an N-terminal collagenous domain and a C-terminal C1q-like globular domain. The globular domain, gAdiponectin or gAcrp30, can be generated by proteolytic cleavage .

5.2. Biological Activities

Adiponectin is known for its anti-diabetic and anti-atherogenic properties, playing roles in regulating lipid and glucose metabolism . Recombinant gAdiponectin has been shown to inhibit the proliferation of mouse M1 myeloid cells .

5.3. Receptors

Two receptors, AdipoR1 and AdipoR2, mediate the effects of Adiponectin. AdipoR1, predominantly expressed in muscle, is a high-affinity receptor for gAdiponectin, while AdipoR2, mainly in the liver, binds both full-length and globular domain Adiponectin .

5.4. Applications

Recombinant mouse gAdiponectin/gAcrp30 protein is used in various applications, including in vivo studies and bioassays . For instance, it has been used to demonstrate that central adiponectin acutely improves glucose tolerance in male mice .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
UPF0353 protein MAV335
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium avium
Target Protein Sequence
MSLPFLGPMSLSGFEHSWFFLFLLVVAGLAALYILMQLARHGRMLRFANMELLESVAPKR PSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATDVAPNRMA AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEGI FTALQVQAIATVGAVIAGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPI STISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNARSLQELKSVYATLQQQIG YETIKGDASVGWVRLGALVLRLAADALLINRRLPT
Uniprot No.

Target Background

Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing Recombinant UPF0353 protein MAV335?

E. coli expression systems have demonstrated high efficacy for recombinant UPF0353 protein production, as evidenced by successful expression of the related MAP_3435c protein. For optimal results, consider using E. coli strains specifically designed for membrane protein expression, as UPF0353 proteins typically contain transmembrane domains. The addition of an N-terminal His-tag facilitates subsequent purification while maintaining protein functionality .

Recommended expression protocol:

  • Transform expression plasmid into BL21(DE3) or Rosetta 2(DE3) E. coli strains

  • Culture at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.5-1.0 mM IPTG

  • Continue expression at reduced temperature (18-25°C) for 16-20 hours

  • Harvest cells by centrifugation at 5000×g for 15 minutes at 4°C

What purification strategy yields the highest purity for UPF0353 proteins?

A multi-step purification approach is recommended for UPF0353 proteins, beginning with immobilized metal affinity chromatography (IMAC). Based on established protocols for related proteins, >90% purity can be achieved through the following methodology :

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitors)

  • Disrupt cells via sonication or French press

  • Clarify lysate by centrifugation (15,000×g, 30 min, 4°C)

  • Perform IMAC purification using Ni-NTA resin

  • Apply size exclusion chromatography as a polishing step

  • Verify purity via SDS-PAGE (>90% purity is typically achievable)

How should researchers analyze the structural integrity of purified Recombinant UPF0353 protein?

Structural integrity assessment should involve multiple complementary techniques:

  • SDS-PAGE Analysis: Confirms expected molecular weight and initial purity

  • Circular Dichroism (CD) Spectroscopy: Evaluates secondary structure composition

  • Dynamic Light Scattering (DLS): Assesses homogeneity and aggregation state

  • Limited Proteolysis: Identifies stable domains and flexible regions

For UPF0353 proteins, which typically contain transmembrane segments, additional detergent compatibility testing is essential. The protein stability can be monitored in various detergents (DDM, LDAO, OG) to identify optimal conditions for downstream applications. Proper folding can be inferred from monodisperse behavior in size exclusion chromatography profiles .

What are the optimal storage conditions for maintaining UPF0353 protein stability?

Based on established protocols for related UPF0353 proteins, the following storage conditions maximize stability and prevent activity loss :

Storage ParameterRecommendationRationale
Temperature-20°C/-80°CPrevents proteolytic degradation
Buffer CompositionTris/PBS-based buffer, pH 8.0Maintains native conformation
Additives5-50% glycerol (50% optimal)Prevents freeze-thaw damage
Cryoprotectant6% TrehaloseStabilizes protein structure
AliquotingEssentialMinimizes freeze-thaw cycles
Working Storage4°C for up to one weekFor active experiments

For reconstitution after lyophilization, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity .

What experimental approaches are most effective for determining the biological function of UPF0353 family proteins?

UPF0353 proteins remain functionally uncharacterized, presenting unique research opportunities. A multi-faceted approach is recommended:

  • Comparative Genomics: Analyze gene neighborhood and conservation patterns across mycobacterial species

  • Protein Interaction Studies: Apply pull-down assays with His-tagged protein to identify binding partners

  • Phenotypic Analysis: Evaluate knockout/knockdown phenotypes in mycobacterial models

  • Structural Homology Modeling: Generate predictions based on the known 335-amino acid sequence

  • Subcellular Localization: Determine membrane association and topology using GFP fusion constructs

The transmembrane topology prediction based on the amino acid sequence (MKLPLLGPVSVTGFQNPWFFLALLAVLLVIGLYVVQQ...) suggests membrane localization, which should guide experimental design for functional characterization .

How can researchers evaluate potential protein-protein interactions involving UPF0353 proteins?

Methodological approach for protein interaction studies should include:

  • Affinity Chromatography: Using His-tagged UPF0353 as bait

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics

  • Bacterial Two-Hybrid System: For in vivo interaction validation

  • Cross-Linking Mass Spectrometry: To capture transient interactions

  • Co-Immunoprecipitation: When specific antibodies are available

When designing SPR experiments, consider using methodology similar to that applied for other membrane proteins. Immobilize the His-tagged UPF0353 protein on a Ni-NTA sensor chip and flow potential interaction partners over the surface. Control experiments using unrelated proteins are essential to distinguish specific from non-specific binding .

What are the challenges in crystallizing UPF0353 family proteins and how can they be addressed?

Membrane-associated proteins like UPF0353 present significant crystallization challenges:

ChallengeMethodological Solution
Hydrophobic regionsUse of specific detergents (DDM, LDAO) or amphipols
Conformational heterogeneityAddition of stabilizing ligands or antibody fragments
Low expression yieldsOptimization of expression conditions or fusion partners
Crystallization difficultyLipidic cubic phase crystallization or vapor diffusion with specific additives

For UPF0353 specifically, consider screening with membrane-mimetic systems and utilizing the full-length construct (335 amino acids) with minimal modifications to the native sequence. The addition of stabilizing antibody fragments, similar to those developed for other membrane proteins, may facilitate crystallization by reducing conformational flexibility .

How can researchers effectively compare UPF0353 proteins from different mycobacterial species?

Comprehensive comparative analysis should incorporate:

  • Sequence Alignment: Multiple sequence alignment using CLUSTAL Omega or MUSCLE

  • Phylogenetic Analysis: Construction of phylogenetic trees to understand evolutionary relationships

  • Structural Modeling: Homology modeling of different UPF0353 orthologs

  • Expression Profiling: Comparison of expression patterns under various conditions

  • Functional Complementation: Cross-species complementation studies in knockout models

When analyzing sequence conservation, particular attention should be paid to the transmembrane regions and potential functional motifs. The high conservation of UPF0353 across mycobacterial species suggests important functional roles, possibly in membrane integrity or transport .

What strategies can address protein insolubility issues during UPF0353 protein expression?

Membrane-associated proteins like UPF0353 often present solubility challenges. Implementation of these methodological adjustments can significantly improve results:

  • Reduce expression temperature to 16-18°C during induction

  • Modify induction conditions (IPTG concentration 0.1-0.5 mM)

  • Incorporate detergents during cell lysis (0.5-1% DDM or LDAO)

  • Test fusion partners (MBP, SUMO) to enhance solubility

  • Optimize lysis buffer composition with glycerol (10%) and salt (300-500 mM NaCl)

For extraction of membrane-associated UPF0353 proteins, a sequential extraction protocol is recommended, beginning with milder detergents and progressing to stronger ones if necessary. Complete solubilization typically requires optimization of detergent:protein ratios through systematic screening .

How can researchers verify the functional integrity of purified UPF0353 protein?

In the absence of known enzymatic activity, alternative approaches to confirm functional integrity include:

  • Thermal Shift Assays: Monitor protein stability under varying conditions

  • Binding Assays: Test interaction with potential ligands or lipids

  • Circular Dichroism: Compare spectra with predictions based on sequence

  • Limited Proteolysis: Assess resistance to digestion as indicator of proper folding

  • Native PAGE: Evaluate oligomeric state and homogeneity

A properly folded UPF0353 protein should exhibit a defined melting temperature in thermal shift assays and produce CD spectra consistent with its predicted secondary structure composition (predominantly alpha-helical based on sequence analysis) .

What considerations are important when developing antibodies against UPF0353 proteins?

Development of specific antibodies against UPF0353 proteins requires careful consideration of multiple factors:

  • Epitope Selection: Choose unique, exposed regions of the protein

  • Antigen Preparation: Use both peptide and properly folded protein antigens

  • Validation Strategy: Implement multiple validation techniques, including knockout controls

  • Cross-Reactivity Testing: Assess reactivity against related UPF0353 proteins

  • Application-Specific Optimization: Different applications (Western blot, immunoprecipitation, etc.) may require different antibody properties

What are the key considerations for designing protein interaction studies involving UPF0353 proteins?

When designing protein interaction studies, researchers should consider:

  • Native Conformation Preservation: Maintain proper folding using appropriate detergents

  • Control Experiments: Include both positive and negative interaction controls

  • Detection Sensitivity: Optimize detection methods for potentially weak interactions

  • Validation Approach: Confirm interactions using orthogonal methods

  • Physiological Relevance: Assess interactions under conditions that mimic the native environment

The implementation of phage display approaches, similar to those used for identifying antibodies against membrane proteins, may be particularly valuable for identifying novel UPF0353 binding partners. This technique allows for high-throughput screening of potential interactors while maintaining native protein conformation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.