Recombinant UPF0353 protein Mb1517 (Mb1517)

What is UPF0353 protein Mb1517 and what organism does it originate from?

UPF0353 protein Mb1517 is a protein encoded by the Mb1517 gene in Mycobacterium bovis. It belongs to the UPF0353 protein family, a group of proteins with unknown function. The protein consists of 335 amino acids and has been assigned the UniProt accession number P64856 . Recombinant versions of this protein are commonly used for research purposes, often produced with affinity tags such as His-tags to facilitate purification and downstream applications .

What expression systems are most effective for producing recombinant Mb1517 protein?

Escherichia coli is the most commonly used expression system for producing recombinant Mb1517. E. coli is routinely employed for recombinant protein production both for research and commercial applications due to its rapid growth, well-established genetic tools, and high protein yields . For expressing Mb1517 specifically, E. coli strains such as JM109 (recA, endA1, gyrA96, thi, hsdR17, supE44, relA1, Δ(lac-proAB), F' traD36, proAB, lacIqZΔM15) or M15 strains are suitable options . The protein is typically expressed with a His-tag to facilitate downstream purification processes .

How can I optimize media conditions to improve the yield of recombinant Mb1517?

Media optimization is crucial for maximizing recombinant protein production. Research indicates that different media formulations can significantly impact the expression levels of recombinant proteins in E. coli. For structured optimization, consider the following approach:

• Initial Media Screening: Test multiple media formulations including:

  • Glucose M9Y

  • LB Broth (Miller)

  • Specialized formulations like Hyper Broth™, Power Broth™, Superior Broth™, and Turbo Broth™

• Growth Protocol:

  • Inoculate overnight cultures in LB (Miller) Broth at 37°C

  • Transfer 0.1 ml of overnight culture to 2 ml of each test medium

  • Incubate at 37°C with shaking at 250 rpm until OD600 reaches 0.6

  • Induce protein expression with IPTG (typically 1 mM)

  • Continue incubation for 3 hours

  • Harvest cells and analyze protein expression

• Analysis Methods:

  • Use SDS-PAGE to assess relative levels of recombinant protein accumulation

  • For quantitative comparisons, normalize samples to equal OD600 values or total protein content

This systematic approach allows for identification of the optimal medium for your specific recombinant protein expression, as different proteins may show varying expression patterns in different media formulations.

What purification strategies are recommended for His-tagged Mb1517?

For His-tagged Mb1517 protein, the following purification strategy is recommended:

• Cell Lysis: Disrupt cells using sonication, French press, or chemical lysis methods in an appropriate buffer (typically Tris-based) containing protease inhibitors.

• Immobilized Metal Affinity Chromatography (IMAC):

  • Use Ni-NTA or similar affinity resins

  • Equilibrate column with binding buffer (typically containing 10-20 mM imidazole)

  • Apply clarified cell lysate

  • Wash with buffer containing 20-50 mM imidazole to remove non-specifically bound proteins

  • Elute His-tagged Mb1517 with buffer containing 250-500 mM imidazole

• Buffer Exchange/Dialysis: Remove imidazole and adjust to storage buffer (typically Tris-based buffer with 50% glycerol for stability)

• Quality Control:

  • Verify purity by SDS-PAGE

  • Confirm identity by Western blot or mass spectrometry if necessary

• Storage: Store at -20°C for short-term or -80°C for long-term stability. Avoid repeated freeze-thaw cycles, and consider working aliquots stored at 4°C for up to one week .

What computational tools can be used to predict the function of UPF0353 protein Mb1517?

Given that Mb1517 belongs to the UPF (Uncharacterized Protein Family) classification, its function remains largely unknown. Researchers can employ several computational approaches to predict its potential function:

• Sequence Homology Analysis:

  • Use BLAST to identify similar proteins with known functions

  • Search conserved domain databases (CDD, PFAM, InterPro) to identify functional domains

• Structural Prediction:

  • Use AlphaFold or similar tools to predict 3D structure

  • Compare predicted structures with known protein structures using tools like Dali or VAST

• Genomic Context Analysis:

  • Examine neighboring genes and operonic structure in Mycobacterium bovis

  • Look for conserved gene neighborhoods across related species

• Protein-Protein Interaction Prediction:

  • Use tools like STRING to predict potential interaction partners

  • Analyze co-expression patterns with other mycobacterial proteins

These computational approaches can provide initial hypotheses about Mb1517 function that can be subsequently tested through experimental methods.

What experimental approaches can be used to investigate the function of Mb1517?

To experimentally characterize the function of Mb1517, researchers can employ multiple complementary approaches:

• Gene Knockout/Knockdown Studies:

  • Create gene deletion mutants in M. bovis

  • Assess phenotypic changes in growth, stress response, and virulence

• Protein Interaction Studies:

  • Perform pull-down assays using purified His-tagged Mb1517

  • Conduct yeast two-hybrid screening

  • Use proximity labeling methods like BioID or APEX

• Localization Studies:

  • Generate fluorescently-tagged versions of Mb1517

  • Perform subcellular fractionation followed by Western blotting

• Biochemical Characterization:

  • Test for enzymatic activities (e.g., ATPase, GTPase, protease)

  • Assess binding to nucleic acids, metals, or other cofactors

• Structural Studies:

  • Perform X-ray crystallography or cryo-EM to determine the 3D structure

  • Use NMR to study protein dynamics and interactions

Combining these approaches provides a comprehensive strategy for elucidating the biological role of this uncharacterized protein in mycobacterial physiology.

How can I design experiments to identify interaction partners of Mb1517?

Identifying protein-protein interactions is crucial for understanding the function of uncharacterized proteins like Mb1517. A comprehensive experimental design would include:

• Affinity Purification-Mass Spectrometry (AP-MS):

  • Express His-tagged Mb1517 in M. bovis or in a heterologous system

  • Perform pull-down experiments using Ni-NTA or anti-His antibodies

  • Analyze co-purified proteins by mass spectrometry

  • Include appropriate controls (e.g., untagged proteins, irrelevant tagged proteins)

• Crosslinking-MS Approaches:

  • Use chemical crosslinkers to stabilize transient interactions

  • Perform MS analysis to identify crosslinked peptides

  • Reconstruct interaction networks from crosslinking data

• Proximity-Based Labeling:

  • Create fusion proteins of Mb1517 with BioID or APEX2

  • Express in mycobacterial cells and activate labeling

  • Purify biotinylated proteins and identify by MS

• Yeast Two-Hybrid Screening:

  • Use Mb1517 as bait to screen mycobacterial genomic or cDNA libraries

  • Validate positive interactions by secondary assays

• Validation Studies:

  • Confirm interactions by co-immunoprecipitation

  • Use fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC)

  • Assess functional relevance through genetic studies (e.g., epistasis analysis)

This multi-faceted approach increases confidence in identified interactions and helps build a functional interaction network around Mb1517.

What methodologies are recommended for studying the membrane topology of Mb1517?

The amino acid sequence of Mb1517 suggests it may contain transmembrane domains (e.g., "MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRR") . To study its membrane topology, researchers should consider these methodologies:

• Computational Prediction:

  • Use tools like TMHMM, Phobius, or TOPCONS to predict transmembrane regions

  • Identify potential signal peptides using SignalP

• Experimental Topology Mapping:

  • Create fusion proteins with reporter tags (e.g., PhoA, GFP, or split GFP)

  • Position the tags at different predicted loops or termini

  • Assess accessibility/activity to determine cytoplasmic vs. periplasmic localization

• Protease Protection Assays:

  • Prepare membrane vesicles or proteoliposomes containing Mb1517

  • Treat with proteases (e.g., trypsin, proteinase K)

  • Analyze proteolytic fragments by Western blotting with antibodies against different regions

• Chemical Labeling:

  • Use membrane-impermeable labeling reagents to identify exposed regions

  • Perform mass spectrometry to identify labeled residues

• Cryo-EM or X-ray Crystallography:

  • For definitive structural information, purify and reconstitute in membrane mimetics

  • Determine high-resolution structure by cryo-EM or X-ray crystallography

These complementary approaches would provide comprehensive insights into the membrane association and topology of Mb1517, which is critical for understanding its cellular function.

How can I study potential post-translational modifications of Mb1517?

Post-translational modifications (PTMs) often regulate protein function, localization, and interactions. To investigate PTMs of Mb1517:

• Computational Prediction:

  • Use tools like NetPhos, GPS, or ModPred to predict potential phosphorylation, glycosylation, and other modification sites

  • Identify conserved motifs recognized by known modification enzymes

• Mass Spectrometry-Based Identification:

  • Purify recombinant or native Mb1517 from mycobacterial cells

  • Perform tryptic digestion followed by LC-MS/MS analysis

  • Use enrichment strategies for specific modifications:

    • Phosphopeptide enrichment using TiO2 or IMAC

    • Glycopeptide enrichment using lectins or HILIC

    • Ubiquitination detection via K-ε-GG antibodies

• Site-Directed Mutagenesis:

  • Mutate predicted modification sites (e.g., S/T/Y for phosphorylation)

  • Express mutant proteins and assess functional consequences

  • Compare PTM patterns of wild-type and mutant proteins by MS

• In Vitro Modification Assays:

  • Incubate purified Mb1517 with relevant kinases, glycosyltransferases, or other modification enzymes

  • Detect modifications using specific antibodies or MS

• PTM-Specific Antibodies:

  • Develop or procure antibodies against predicted modifications

  • Perform Western blotting under different conditions to monitor dynamic changes in modifications

This multilayered approach would provide insights into the PTM landscape of Mb1517 and its functional significance in mycobacterial physiology.

How can I improve solubility and stability of recombinant Mb1517 during expression and purification?

Recombinant proteins from mycobacterial sources may present solubility challenges. Consider these approaches to improve Mb1517 solubility and stability:

• Expression Conditions Optimization:

  • Lower induction temperature (16-25°C instead of 37°C)

  • Reduce IPTG concentration (0.1-0.5 mM instead of 1 mM)

  • Test different E. coli host strains (e.g., BL21(DE3), Rosetta, Arctic Express)

  • Optimize media composition as discussed in section 2.2

• Solubility-Enhancing Tags and Fusion Partners:

  • MBP (maltose-binding protein)

  • SUMO

  • Thioredoxin

  • GST (glutathione S-transferase)

• Buffer Optimization:

  • Screen different pH conditions (pH 6.0-8.5)

  • Test various salt concentrations (100-500 mM NaCl)

  • Add stabilizing agents:

    • Glycerol (10-50%)

    • Reducing agents (DTT, β-mercaptoethanol)

    • Mild detergents for membrane-associated proteins (DDM, CHAPS)

• Storage Recommendations:

  • Store in Tris-based buffer with 50% glycerol at -20°C

  • For extended storage, keep at -80°C

  • Avoid repeated freeze-thaw cycles

  • Create working aliquots for short-term use at 4°C (up to one week)

Implementation of these strategies should significantly improve the handling and stability of recombinant Mb1517 during experimental procedures.

What methods can be used to validate the structural integrity of purified Mb1517?

Ensuring the structural integrity of purified Mb1517 is essential for reliable functional studies. Recommended validation methods include:

• Circular Dichroism (CD) Spectroscopy:

  • Assess secondary structure content (α-helices, β-sheets)

  • Monitor thermal stability and folding

  • Compare with computational predictions

• Size Exclusion Chromatography (SEC):

  • Evaluate oligomeric state and aggregation

  • Detect major conformational changes

  • Combine with multi-angle light scattering (SEC-MALS) for precise molecular weight determination

• Dynamic Light Scattering (DLS):

  • Measure particle size distribution

  • Monitor protein aggregation

  • Assess sample homogeneity

• Differential Scanning Fluorimetry (DSF)/Thermal Shift Assay:

  • Determine thermal stability (Tm)

  • Screen stabilizing buffer conditions

  • Assess ligand binding by shifts in Tm

• Limited Proteolysis:

  • Probe tertiary structure through accessibility to proteases

  • Compare digestion patterns between batches

  • Identify stable domains for structural studies

These methods collectively provide a robust assessment of protein quality and structural integrity before proceeding with functional studies or more advanced structural characterization.

How does Mb1517 compare to homologous proteins in other mycobacterial species?

Understanding the evolutionary relationships and functional conservation of Mb1517 across mycobacterial species provides valuable insights into its biological significance:

• Sequence Conservation Analysis:

  • Perform multiple sequence alignment of Mb1517 homologs

  • Identify highly conserved residues and motifs

  • Construct phylogenetic trees to visualize evolutionary relationships

• Structural Comparison:

  • Compare predicted or experimentally determined structures

  • Identify conserved structural elements

  • Map conservation onto structural models to identify functional surfaces

• Genomic Context Analysis:

  • Examine conservation of neighboring genes across species

  • Identify operonic structures and potential co-regulation

  • Look for synteny breaks that might indicate functional divergence

• Expression Pattern Comparison:

  • Analyze transcriptomic data across species under similar conditions

  • Identify common regulatory patterns

  • Compare expression changes in response to environmental stresses

This comparative approach helps distinguish conserved functional elements from species-specific adaptations and can guide experimental design for functional characterization.

What are the key differences between UPF0353 proteins and other protein families with known functions?

While UPF0353 proteins like Mb1517 remain functionally uncharacterized, comparing them with well-characterized protein families can provide functional hypotheses:

• Domain Architecture Analysis:

  • Identify any recognizable domains within UPF0353 proteins

  • Compare with domain organizations of proteins with known functions

  • Look for partial homology to characterized domains

• Structural Fold Comparison:

  • Compare predicted secondary and tertiary structures with known protein folds

  • Identify structural similarities that might suggest functional similarities

  • Look for conserved catalytic triads or binding pockets

• Evolutionary Classification:

  • Determine if UPF0353 belongs to larger superfamilies

  • Look for distant homology relationships using sensitive methods like HHpred

  • Track evolutionary history to identify potential functional shifts

• Biochemical Property Comparison:

  • Compare physicochemical properties (charge distribution, hydrophobicity)

  • Identify potential active sites or binding interfaces

  • Analyze conservation patterns in the context of known functional mechanisms

This systematic comparison approach bridges the gap between uncharacterized and characterized protein families, generating testable hypotheses about UPF0353 protein function.

What are the recommended standards for documenting experiments with recombinant Mb1517?

Proper documentation ensures reproducibility and facilitates data sharing in the research community. For Mb1517 research, adhere to these documentation standards:

• Protein Production and Purification:

  • Record complete expression construct details (vector, tags, cloning sites)

  • Document expression conditions (strain, media, temperature, induction parameters)

  • Detail each purification step with buffer compositions

  • Include quality control data (SDS-PAGE, Western blot, mass spectrometry)

  • Report final yield, concentration, and storage conditions

• Functional Assays:

  • Provide detailed protocols with all reagents and their concentrations

  • Document all experimental conditions (temperature, pH, time)

  • Include all controls (positive, negative, technical)

  • Present raw data alongside processed results

  • Report statistical analysis methods and parameters

• Data Presentation:

  • Present results in standardized formats (tables, graphs)

  • Include error bars and statistical significance indicators

  • Ensure all axes and conditions are clearly labeled

  • Provide access to raw data when possible

• Method Validation:

  • Document method development and optimization steps

  • Include calibration data and standard curves

  • Assess and report assay sensitivity, specificity, and reproducibility

Following these documentation practices ensures research transparency and facilitates the replication and extension of findings by other researchers in the field.

How should experimental data on Mb1517 be stored and shared with the research community?

Effective data management and sharing accelerates scientific discovery. For Mb1517 research:

• Data Storage Best Practices:

  • Implement consistent file naming conventions

  • Organize data in logical folder structures

  • Maintain detailed electronic lab notebooks

  • Create regular backups on multiple platforms

  • Use version control for analysis scripts and protocols

• Data Repositories:

  • Deposit protein sequences in UniProt

  • Share structural data in the Protein Data Bank (PDB)

  • Submit mass spectrometry data to ProteomeXchange

  • Upload genomic data to GenBank or similar repositories

  • Share functional annotations through GO (Gene Ontology) databases

• Publication and Preprint Sharing:

  • Submit research to peer-reviewed journals

  • Consider preprint servers like bioRxiv for early sharing

  • Include detailed methods sections and supplementary data

  • Provide access to analysis scripts and custom software

• Collaborative Tools:

  • Use electronic lab notebooks with sharing capabilities

  • Employ project management platforms for team coordination

  • Consider open science frameworks for collaborative projects

Adhering to FAIR principles (Findable, Accessible, Interoperable, Reusable) ensures that research on this understudied protein contributes maximally to scientific knowledge.

What are the most promising research areas for further characterization of Mb1517?

Based on current knowledge, several promising research directions for Mb1517 include:

• Structural Biology Approaches:

  • High-resolution structure determination using X-ray crystallography or cryo-EM

  • NMR studies to identify dynamic regions and potential binding sites

  • Computational modeling and molecular dynamics simulations

• Functional Genomics:

  • CRISPR-based gene editing to generate knockout or knockdown mutants

  • Phenotypic characterization under various stress conditions

  • Transcriptomic and proteomic profiling of mutant strains

• Interactome Mapping:

  • Systematic identification of protein-protein and protein-nucleic acid interactions

  • Characterization of membrane associations and potential complexes

  • Integration of interaction data with other -omics datasets

• Comparative Studies Across Mycobacterial Species:

  • Evolutionary analysis across pathogenic and non-pathogenic mycobacteria

  • Functional complementation studies across species

  • Host-pathogen interaction analyses for virulent species

• Translational Applications:

  • Assessment of Mb1517 as a potential drug target

  • Development of diagnostic tools based on Mb1517 detection

  • Evaluation as a potential vaccine component

These research directions would significantly advance our understanding of this uncharacterized protein and potentially reveal new aspects of mycobacterial biology.

What new technologies might enhance research on proteins like Mb1517 in the near future?

Emerging technologies hold promise for accelerating research on uncharacterized proteins like Mb1517:

• Advanced Structural Biology Methods:

  • Cryo-electron tomography for in situ structural analysis

  • Integrative structural biology combining multiple data types

  • Time-resolved structural studies for capturing dynamic processes

• Single-Cell and Spatial Technologies:

  • Single-cell proteomics to capture cell-to-cell variation

  • Spatial transcriptomics and proteomics to map subcellular localization

  • Advanced microscopy techniques with super-resolution capabilities

• AI and Computational Approaches:

  • Improved protein structure prediction through deep learning

  • Enhanced functional annotation through integrative data analysis

  • Automated literature mining for hypothesis generation

• Genome and Protein Engineering:

  • CRISPR-based technologies for precise genetic manipulation

  • Expanded genetic code for site-specific incorporation of non-canonical amino acids

  • Protein design approaches for creating functional probes

• High-Throughput Screening Technologies:

  • Microfluidic platforms for rapid phenotypic screening

  • Multiplexed assays for parallel functional characterization

  • Automated systems for protein expression and purification optimization