Recombinant UPF0353 protein Rv1481/MT1528 (Rv1481, MT1528)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Target Names
Rv1481, MT1528
Target Protein Sequence
MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY ETIKGDASVGWLRLGALALALAALAALLINRRLPT
Uniprot No.

Q&A

What is Rv1481/MT1528 and where is it located in Mycobacterium tuberculosis?

Rv1481/MT1528 is classified as a UPF0353 protein and is described as a possible membrane protein in Mycobacterium tuberculosis. The gene is located at position 1671377-1672384 on the positive strand of the M. tuberculosis genome. The coding sequence is 1008 nucleotides long, encoding a protein of 335 amino acids. Cellular localization studies indicate that the protein is integral to the plasma membrane, suggesting it plays a role in membrane-associated functions . The protein's membrane localization is consistent with its amino acid sequence characteristics, which include transmembrane regions that facilitate its integration into the cell membrane structure.

What genomic regulatory elements control Rv1481 expression?

Rv1481 is predicted to be co-regulated within specific gene modules, notably bicluster_0142 with a regulation residual value of 0.59 and bicluster_0236 with a residual value of 0.53. This regulation appears to be mediated by de-novo identified cis-regulatory motifs in each module. For bicluster_0142, the regulatory motifs have e-values of 420.00 and 7,300.00, while for bicluster_0236, they have e-values of 1,500.00 and 1,800.00 .

The co-regulated modules are enriched for several biological processes including DNA topological change, glutamate metabolic processes, dicarboxylic acid biosynthetic processes, DNA conformation change, and DNA topoisomerase activity. Additional enriched processes include cellular macromolecule catabolic processes and tetrapyrrole metabolic and biosynthetic pathways . This regulatory profile suggests Rv1481 may function in coordination with genes involved in these processes, providing insight into its potential physiological roles.

What are the optimal conditions for recombinant expression of Rv1481/MT1528?

For optimal recombinant expression of Rv1481/MT1528, an Escherichia coli expression system is typically employed. The complete coding sequence (amino acids 1-335) is cloned into an expression vector with an N-terminal 10xHis tag to facilitate purification. Following expression, the protein can be provided in either liquid form in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose or as a lyophilized powder .

For storage, it is recommended to maintain the protein at -20°C/-80°C, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles. The shelf life of the liquid form is approximately 6 months at -20°C/-80°C, while the lyophilized form maintains stability for up to 12 months under the same conditions . These expression and storage parameters are critical for maintaining protein integrity for subsequent experimental applications.

How can researchers verify protein-protein interactions involving Rv1481?

Researchers can employ multiple complementary techniques to verify protein-protein interactions involving Rv1481, as demonstrated in studies of similar mycobacterial proteins:

  • Bimolecular Fluorescence Complementation (BiFC) Assay: This technique involves cloning genes encoding the proteins of interest into plasmid vectors harboring non-fluorescent fragments of a fluorescent protein. Upon interaction of the two proteins, the fragments come into proximity and reconstitute a functional fluorescent protein, which can be visualized microscopically .

  • Co-immunoprecipitation (Co-IP): This approach can confirm protein interactions in vivo. For example, a methodology similar to that used for RipA-MoxR interaction could be applied, where one protein (e.g., Rv1481) is expressed with a His-tag and the interacting partner with a different tag (e.g., FLAG). Following co-expression in a suitable host (such as M. smegmatis), the complex is purified using Ni-NTA beads, and the interacting partner is detected using specific antibodies .

  • In silico prediction and validation: Computational methods can first predict potential interaction partners, followed by experimental validation using the methods above. This approach was successful in identifying the interaction between RipA and MoxR1 proteins in M. tuberculosis .

These methodologies provide a robust framework for characterizing protein-protein interactions involving Rv1481, offering insights into its functional networks within the bacterial cell.

What are the known or predicted functions of Rv1481/MT1528 in Mycobacterium tuberculosis?

Rv1481/MT1528 is classified as a possible membrane protein in Mycobacterium tuberculosis, though its precise functions remain to be fully elucidated. Based on genomic and proteomic analyses, several potential functions can be inferred:

  • Membrane-associated roles: Its classification as an integral plasma membrane protein suggests involvement in membrane integrity, transport processes, or signaling .

  • Cholesterol metabolism: The gene has been found to be important for growth on cholesterol, indicating a potential role in lipid metabolism, which is critical for M. tuberculosis survival in host cells .

  • Co-regulation with specific pathways: The protein is co-regulated with genes involved in DNA topology, glutamate metabolism, and tetrapyrrole biosynthesis, suggesting functional associations with these processes .

The protein belongs to the UPF0353 family, a group of proteins whose functions are not yet experimentally characterized ("UPF" stands for Uncharacterized Protein Family). This classification highlights the need for further research to definitively establish its biological roles in mycobacterial physiology and pathogenesis.

How does Rv1481 contribute to M. tuberculosis pathogenicity?

While direct evidence for Rv1481's contribution to pathogenicity is limited in the provided search results, several aspects suggest potential roles in virulence:

Research methodologies to further investigate Rv1481's role in pathogenicity could include gene knockout studies, infection models using mutant strains, and comprehensive protein interaction mapping to identify connections with known virulence factors.

How can structural analysis of Rv1481 inform drug discovery efforts against tuberculosis?

Structural analysis of Rv1481 could significantly contribute to tuberculosis drug discovery through several approaches:

  • Protein structure determination: Using techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to resolve the three-dimensional structure of Rv1481. This would reveal potential binding pockets that could be targeted by small-molecule inhibitors.

  • Structure-based virtual screening: Once the structure is determined, computational methods can screen virtual libraries of compounds to identify molecules predicted to bind to functional sites on Rv1481.

  • Molecular dynamics simulations: These can reveal conformational changes in the protein that might expose transient binding sites not visible in static structures.

  • Fragment-based drug discovery: This approach identifies small molecular fragments that bind weakly to different sites on the protein, which can then be linked or expanded into high-affinity drug candidates.

The importance of membrane proteins as drug targets is well-established, with approximately 60% of current therapeutic drugs targeting membrane proteins. As an integral membrane protein potentially involved in cholesterol metabolism and bacterial survival, Rv1481 represents a promising target for novel antitubercular agents . Targeting pathways essential for bacterial survival in host environments, such as cholesterol utilization, offers strategies for developing drugs that specifically inhibit pathogen persistence mechanisms.

What are the implications of Rv1481's co-regulation patterns for understanding M. tuberculosis adaptation mechanisms?

The co-regulation patterns of Rv1481 with specific gene modules provide valuable insights into M. tuberculosis adaptation mechanisms:

Co-regulation ModuleResidual ValueAssociated Biological ProcessesPotential Adaptation Significance
Bicluster_01420.59DNA topological change, DNA conformation change, DNA topoisomerase activityPossible role in stress response, adaptation to environmental changes, DNA protection mechanisms
Bicluster_02360.53Glutamate metabolism, dicarboxylic acid biosynthesis, tetrapyrrole metabolismInvolvement in metabolic adaptation, nutritional stress response, alternative energy pathway utilization

This co-regulation suggests Rv1481 functions within networks that help M. tuberculosis adapt to changing environmental conditions, particularly during infection. The association with DNA topology genes is especially noteworthy, as changes in DNA supercoiling are a known bacterial response to environmental stresses . Similarly, metabolic pathway adaptations represented in Bicluster_0236 may contribute to the pathogen's remarkable ability to survive within diverse host microenvironments.

Research investigating how these co-regulation patterns change under different stress conditions (oxidative stress, nutrient limitation, antibiotic exposure) could provide deeper understanding of Rv1481's role in adaptation mechanisms and potential vulnerability points for therapeutic intervention.

What are common challenges in working with recombinant Rv1481 and how can they be addressed?

Researchers working with recombinant Rv1481 may encounter several technical challenges:

  • Protein solubility issues: As a membrane protein, Rv1481 may have limited solubility in aqueous buffers.

    • Solution: Use detergents or lipid nanodisc systems to mimic the membrane environment. Tris/PBS-based buffers with 6% trehalose (as used in commercial preparations) help maintain solubility .

  • Protein aggregation during storage:

    • Solution: Store at -20°C/-80°C with proper aliquoting to avoid repeated freeze-thaw cycles. The shelf life in liquid form is approximately 6 months, while lyophilized preparations can maintain stability for up to 12 months .

  • Expression and purification difficulties:

    • Solution: Optimize codon usage for the expression system, use N-terminal tags (such as 10xHis) for purification, and adjust induction conditions. Expression in E. coli systems has been successfully demonstrated .

  • Functional assay development:

    • Solution: Consider using approaches similar to those applied for other mycobacterial proteins, such as bimolecular fluorescence complementation or co-immunoprecipitation to study protein-protein interactions .

  • Structural characterization challenges:

    • Solution: Consider detergent screening, lipid cubic phase crystallization for X-ray studies, or NMR approaches optimized for membrane proteins.

Thorough documentation of experimental conditions that successfully address these challenges will contribute significantly to research progress in this field.

How can researchers interpret contradictory data regarding Rv1481's function in different experimental systems?

When faced with contradictory data regarding Rv1481's function, researchers should consider a systematic approach to data interpretation:

  • Evaluate experimental contexts: Different expression systems, host cells, or environmental conditions can significantly impact protein function. Compare methodological details including:

    • Expression systems used (E. coli vs. mycobacterial hosts)

    • Tags and fusion partners that might affect function

    • Buffer compositions and experimental conditions

    • In vitro versus in vivo assays

  • Consider post-translational modifications: M. tuberculosis proteins may undergo modifications that are not replicated in heterologous expression systems.

  • Examine protein-protein interaction networks: Contradictory functions might reflect different interaction partners in different systems. Methods similar to those used to study RipA-MoxR1 interactions could be applied to map Rv1481's interactome comprehensively .

  • Assess gene regulation context: The co-regulation of Rv1481 with different gene modules suggests potentially diverse functions depending on cellular conditions .

  • Design validation experiments: To resolve contradictions, design experiments that directly test competing hypotheses, ideally using complementary methodologies and both in vitro and in vivo systems.

A comprehensive approach that combines structural biology, protein interaction studies, and functional genomics will likely be necessary to fully resolve contradictory observations and establish the definitive functions of Rv1481 in mycobacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.