Recombinant UPF0359 membrane protein CBG21730 (CBG21730)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your requests if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tpra-1; CBG21730; Transmembrane protein adipocyte-associated 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-454
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
tpra-1
Target Protein Sequence
MSVIFHENPGTSLGSVVSSDTNPSFNHTLSIETSPEWIDDLFSNVSFIDSTTHQVIRGFC RDVFVYRLPGGFRIRYWDAAILIPNLLFLLFLFLKCTSVIRKLQTGNSPVLRAFTLLVYV STLVNIIRCVYSMTLSMTDGIEQTVDQTLWIIIKFFYLTAEFCALTFGLLFGHLDNGRSI LIALLGTLLVSIPHTAVQVIVEMKIIDNSWLPLTYFDIESDGGFVFWVLSSATLALVYFF IMCLPLVCCQKYTKLPSNGSFFIYCMMMVTLNILQSMGAALILFKSSDGLCFVGVSTYVY FVLYPPIIYFTFLRRKLKTPPNNTSGLFMYRKHKDEQGSGDLPDSYYPRFSGLTSPSYDD LFDYDRDARFTHYDISTNEYVQHPHYNTYSTPLIMSTVETAESTVTTRTGSDDFAHHRDS MLSEPSTGTTTRHLKGLGPQGSLVFEEDPSSLRL
Uniprot No.

Target Background

Protein Families
UPF0359 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is UPF0359 membrane protein CBG21730 and what are its key molecular features?

UPF0359 membrane protein CBG21730 (UniProt accession: Q60QP4) is a transmembrane protein found in Caenorhabditis briggsae, commonly referred to by its gene name tpra-1 (Transmembrane protein adipocyte-associated 1 homolog) . The full-length protein consists of 454 amino acids with multiple predicted transmembrane domains evident from its hydrophobic sequence patterns . The protein's amino acid sequence includes characteristic membrane-spanning regions rich in hydrophobic residues, which is typical of integral membrane proteins . Its structural features suggest it plays a role in membrane processes, though detailed functional characterization remains an area of active investigation.

How can researchers obtain recombinant UPF0359 membrane protein CBG21730 for experimental studies?

Researchers can obtain recombinant UPF0359 membrane protein CBG21730 through expression in several host systems. While E. coli expression systems offer the advantage of high yields and relatively shorter production times , alternative expression platforms include baculovirus-infected insect cells for more complex post-translational modifications . The recombinant protein can be acquired in either liquid or lyophilized powder format, with most suppliers providing options for tag configurations (commonly N-terminal His tags) . Researchers should select the expression system based on their specific experimental requirements, particularly if native folding and post-translational modifications are critical to their studies.

What are the optimal storage conditions for maintaining recombinant UPF0359 membrane protein CBG21730 stability?

For optimal stability, recombinant UPF0359 membrane protein CBG21730 should be stored at -20°C to -80°C, with the latter preferred for extended storage periods . The stability profile differs based on the preparation format: liquid formulations typically maintain integrity for approximately 6 months, while lyophilized preparations extend shelf-life to approximately 12 months at these temperatures . To minimize protein degradation, it is strongly recommended to aliquot the stock solution, adding 5-50% glycerol (with 50% being a common final concentration) as a cryoprotectant, and to avoid repeated freeze-thaw cycles . For short-term work, aliquots can be maintained at 4°C for up to one week without significant degradation .

What expression system yields the most functionally active UPF0359 membrane protein CBG21730?

While multiple expression systems can produce recombinant UPF0359 membrane protein CBG21730, their suitability varies depending on research objectives. E. coli expression systems provide cost-effective production with reasonable yields , but may lack some post-translational modifications. For studies requiring more native-like protein folding and modification profiles, baculovirus-mediated expression in insect cells represents a superior alternative . When functional activity is paramount, insect cell or mammalian expression systems should be prioritized as they can provide many of the post-translational modifications necessary for correct protein functionality . The decision matrix should weigh factors including intended downstream applications, requirement for specific post-translational modifications, and resource constraints.

How can researchers verify the structural integrity of purified UPF0359 membrane protein CBG21730?

Verifying structural integrity of purified UPF0359 membrane protein CBG21730 requires multiple complementary analytical approaches. Initial quality assessment should include SDS-PAGE analysis to confirm the expected molecular weight and purity (>85% as typical specification) . Circular dichroism spectroscopy can provide valuable information about secondary structure elements, particularly important for confirming the alpha-helical content typical of transmembrane domains. For more detailed structural verification, limited proteolysis coupled with mass spectrometry can map accessible regions versus protected transmembrane segments. Advanced techniques like cryo-electron microscopy, which has been successfully applied to membrane proteins solubilized with WRAPs technology yielding structures at 4.0 Å resolution , could potentially provide high-resolution structural information if sample homogeneity is sufficient. Functional assays specific to the protein's activity would provide the ultimate verification that the purified protein maintains its native conformation.

What reconstitution methods are recommended for functional studies of UPF0359 membrane protein CBG21730?

For functional studies requiring reconstitution of UPF0359 membrane protein CBG21730 into membrane-mimetic environments, researchers should begin with careful rehydration protocols. The lyophilized protein should first undergo controlled rehydration by brief centrifugation followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For incorporation into artificial membranes, several methodologies can be employed: (1) reconstitution into detergent-solubilized liposomes followed by detergent removal via dialysis or bio-beads; (2) direct incorporation into nanodiscs using membrane scaffold proteins; or (3) utilization of newer technologies like WRAPs that maintain membrane protein solubility and functionality without conventional detergents . For optimal functional preservation, the reconstitution buffer composition should be carefully optimized, potentially including stabilizing agents like glycerol at 5-50% final concentration based on application requirements .

What analytical techniques are most effective for studying UPF0359 membrane protein CBG21730 interactions with other biomolecules?

Investigating UPF0359 membrane protein CBG21730 interactions requires techniques suitable for membrane protein analysis. Surface plasmon resonance (SPR) offers real-time, label-free detection of binding interactions when the protein is properly immobilized while maintaining its native conformation. Microscale thermophoresis (MST) provides an alternative that requires minimal protein amounts and can accommodate membrane proteins in various solubilization systems. For mapping specific interaction sites, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions with altered solvent accessibility upon binding partner association. Proximity-based labeling approaches using enzyme tags (BioID, APEX) can identify interaction partners in complex biological systems. When combined with modern protein solubilization approaches like WRAPs technology, which preserves functionality while improving handling properties , these analytical techniques become more accessible for membrane proteins like CBG21730 which traditionally present significant technical challenges for interaction studies.

How can researchers effectively design experiments to determine the function of UPF0359 membrane protein CBG21730?

Elucidating the function of UPF0359 membrane protein CBG21730 requires a systematic experimental approach. Beginning with sequence analysis to identify conserved domains and motifs, researchers should compare CBG21730 with homologous proteins that have established functions, particularly focusing on its relationship to transmembrane protein adipocyte-associated 1 . Localization studies using fluorescently-tagged versions of the protein can determine its subcellular distribution patterns. Loss-of-function studies in C. briggsae using RNA interference or CRISPR-Cas9 gene editing would reveal phenotypic consequences of protein absence. Complementation experiments with the wild-type or mutated versions of CBG21730 can confirm specific functional domains. For biochemical characterization, reconstituting the purified protein in artificial membrane systems allows for controlled assessment of potential transport, enzymatic, or signaling activities. Advanced methods involving protein solubilization with WRAPs technology could facilitate easier handling and functional studies while preserving native protein activity, as has been demonstrated for other challenging membrane proteins.

How can researchers overcome solubility and stability issues when working with UPF0359 membrane protein CBG21730?

Addressing solubility and stability challenges with UPF0359 membrane protein CBG21730 requires specialized approaches for membrane proteins. During extraction and purification, systematic screening of different detergent classes is essential—starting with mild non-ionic detergents (DDM, LMNG) at concentrations slightly above their critical micelle concentration. Buffer optimization should include evaluation of pH ranges (typically 7.0-8.0), salt concentrations (100-500 mM), and various stabilizing additives such as glycerol (5-50%) or specific lipids that might be required for structural integrity. For long-term stability, limiting freeze-thaw cycles is critical, as recommended in product documentation . The emergent approach of using designed protein WRAPs represents a paradigm shift for membrane protein handling, where custom-designed amphipathic proteins surround the hydrophobic surfaces of membrane proteins, rendering them water-soluble without conventional detergents while preserving their native structure and function . This technology could potentially be adapted specifically for CBG21730 to overcome traditional solubility limitations.

What are potential solutions when recombinant UPF0359 membrane protein CBG21730 shows insufficient purity for downstream applications?

When faced with insufficient purity of recombinant UPF0359 membrane protein CBG21730, researchers should implement a multi-dimensional purification strategy. Starting with affinity chromatography using the N-terminal His-tag , optimization can include: (1) adjusting imidazole concentrations in wash and elution buffers to reduce non-specific binding; (2) adding a second orthogonal purification step such as ion exchange chromatography, selecting the appropriate resin based on the protein's theoretical isoelectric point; and (3) finalizing with size exclusion chromatography to separate oligomeric states and remove aggregates. For particularly challenging contaminants, specialized approaches such as affinity tag cleavage followed by reverse purification or hydroxyapatite chromatography may provide enhanced resolution. Purity should be assessed using multiple analytical methods including SDS-PAGE (targeting >85% purity as specified) , dynamic light scattering to evaluate homogeneity, and mass spectrometry to identify any persistent contaminants. Throughout the purification process, maintaining an appropriate detergent environment or utilizing advanced solubilization technologies like WRAPs is essential for preserving native conformation while achieving the required purity levels.

How can novel protein solubilization technologies enhance research with UPF0359 membrane protein CBG21730?

Recent advances in protein solubilization technologies offer transformative potential for UPF0359 membrane protein CBG21730 research. The innovative WRAPs (Water-soluble RFdiffused Amphipathic Proteins) technology represents a significant breakthrough for membrane protein studies . This deep learning-based design approach creates genetically encoded de novo proteins that specifically surround the hydrophobic surfaces of membrane proteins, rendering them water-soluble without conventional detergents while preserving their sequence, fold, and function . For UPF0359 membrane protein CBG21730, this approach could overcome traditional limitations in expression, purification, and structural characterization. The technology has demonstrated success with both β-barrel and helical transmembrane proteins, improving stability while maintaining native binding and enzymatic functions . Application of WRAPs to CBG21730 could potentially facilitate structural studies via cryo-electron microscopy (achieving resolutions of ~4.0Å as demonstrated with other membrane proteins) , enable more robust biochemical characterization, and simplify handling properties while preserving functional integrity.

What approaches can researchers use to investigate the structure-function relationship of UPF0359 membrane protein CBG21730?

Investigating the structure-function relationship of UPF0359 membrane protein CBG21730 requires an integrated experimental approach. Computational methods can provide initial insights through homology modeling based on similar membrane proteins, predicting transmembrane regions and potential functional domains. Site-directed mutagenesis targeting conserved residues within these predicted functional regions, followed by assays measuring changes in activity, provides experimental validation of computational predictions. Hydrogen-deuterium exchange mass spectrometry can map conformational dynamics and identify regions undergoing structural changes during function. Limited proteolysis combined with mass spectrometry can reveal protected regions indicative of structured domains. For higher-resolution structural studies, modern approaches like single-particle cryo-electron microscopy, potentially facilitated by novel solubilization methods such as WRAPs technology , could provide molecular-level structural information. This technology has enabled structural characterization of challenging membrane proteins at resolutions sufficient to inform functional hypotheses (around 4.0 Å) . Integration of structural data with functional assays will ultimately elucidate the mechanistic details of CBG21730's biological role.

How might UPF0359 membrane protein CBG21730 be utilized in developmental biology research focused on C. briggsae?

UPF0359 membrane protein CBG21730 (tpra-1) offers unique research opportunities in C. briggsae developmental biology. As a transmembrane protein with potential signaling or transport functions, researchers could explore its developmental expression patterns using reporter gene constructs, identifying specific tissues and developmental stages where the protein functions. CRISPR-Cas9-mediated gene editing to create loss-of-function mutations would reveal developmental phenotypes associated with CBG21730 deficiency. Comparative studies between C. briggsae and related nematode species like C. elegans could illuminate evolutionary conservation and divergence in membrane protein function. The recombinant protein could be utilized for generating specific antibodies to facilitate in situ localization studies throughout development . For mechanistic studies, the purified protein could be used in reconstituted systems to identify interaction partners from embryonic or larval extracts. Modern protein solubilization approaches like WRAPs technology could potentially facilitate these interaction studies by maintaining the protein in a native-like conformation without traditional detergents, thereby preserving developmentally relevant protein-protein interactions that might be disrupted in conventional solubilization systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.