Recombinant UPF0359 membrane protein D1046.5 (D1046.5)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

The recombinant protein is produced in diverse systems to optimize yield, solubility, and post-translational modifications:

Host SystemKey FeaturesSource
E. coliHigh yield, cost-effective, His-tagged variants
YeastImproved folding for complex proteins
Mammalian CellsNative-like glycosylation and folding
BaculovirusLarge-scale production for structural studies
Cell-Free SystemsIn vitro expression for rapid synthesis

Purification and Tagging Strategies

Purification relies on affinity tags and conjugates to enhance specificity:

Tag/ConjugateFunctionSource
His-tagNickel-chelating chromatography purification
AviTag + BiotinSite-specific biotinylation for assays
Trehalose BufferStabilizes protein structure during storage

The full-length sequence is preserved in recombinant forms, ensuring structural integrity .

Research Applications

While its exact biological role remains under investigation, potential applications include:

  • Membrane Biology: Studying transmembrane signaling or transport mechanisms.

  • Structural Studies: Crystallization or cryo-EM using His-tagged variants .

  • Functional Assays: Biotinylated AviTag variants enable pull-down or ELISA experiments .

Key Considerations

  • Sequence Conservation: The protein’s homology to adipocyte-associated proteins suggests potential roles in lipid metabolism or cell differentiation .

  • Experimental Design: Choose expression systems based on desired post-translational modifications (e.g., mammalian cells for glycosylation) .

  • Handling Precautions: Avoid denaturation by maintaining consistent storage conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
tpra-1; D1046.5; Transmembrane protein adipocyte-associated 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
tpra-1
Target Protein Sequence
MSVIFHENPGTSLGSVVPDTNTSFERESQLSVKTSPEWIDELFPNVSFIDSPTHQVIRGF CRDVFVYRLPGGFRVRYWDAVILVPNILFLLFLILKCGSVIRKLRTGNSPVLRAFTLLVY VSTLVNIIRCAYSMTLSMTDGLEQTVDQTLWIIIKFFYLTAEFCALTFGLLFGHLDNGKS ILIALLGTLLVSIPHTAVQVIIEMKIIDNSWLPLTYFDIQSDGGFLFWVFSSAVLALVYF FIMCLPLVCCQKYTKLPSKGSFLIYCMMMVVLNVLQSMGAALILFKSSDGLCFVGVSTYV YFVLYPPIIYFTFLRKKLKTPPNNTSGLFMYRKHKDEQGSGDLPDSYYPRFSGLTSPSYD DLFDYDRDARFTHYDISRNEYVQNPHYNTYSTPLIMTSVETAESTVTTRTGSDDYAHHRD SMLSEPSTGTTTRHLKGLGPQGSLVFEDDPSSLTSLRM
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_D1046.5

STRING: 6239.D1046.5a.2

UniGene: Cel.13220

Protein Families
UPF0359 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is UPF0359 membrane protein D1046.5?

UPF0359 membrane protein D1046.5 is a transmembrane protein identified in the nematode Caenorhabditis elegans. It is classified within the UPF (Uncharacterized Protein Family) 0359 group, indicating that its precise function remains to be fully elucidated. The protein is also known by the gene name tpra-1 (Transmembrane protein adipocyte-associated 1 homolog), suggesting potential functional homology with adipocyte-associated proteins in higher organisms . The full-length protein consists of 458 amino acids and is characterized by multiple transmembrane domains typical of integral membrane proteins. Its UniProt accession number is Q18936, which provides standardized reference information in protein databases .

The UPF0359 designation indicates this protein belongs to a family whose functions are not yet well-characterized, making it a subject of interest for researchers studying novel membrane proteins and their potential roles in cellular processes. The presence of multiple transmembrane domains suggests involvement in membrane-associated functions such as transport, signaling, or maintaining membrane structure in C. elegans cells.

What are the optimal storage conditions for recombinant UPF0359 membrane protein D1046.5?

The stability and activity of recombinant UPF0359 membrane protein D1046.5 are highly dependent on proper storage conditions. Based on empirical data, the following storage protocols are recommended:

Storage FormTemperatureShelf LifeSpecial Considerations
Liquid form-20°C/-80°C6 monthsAdd 50% glycerol as cryoprotectant
Lyophilized-20°C/-80°C12 monthsReconstitute immediately before use
Working aliquots4°CUp to 1 weekAvoid repeated freeze-thaw cycles

For long-term storage, the protein should be maintained at -20°C or preferably -80°C in a storage buffer consisting of Tris-based buffer with 50% glycerol, optimized specifically for this protein . The addition of glycerol as a cryoprotectant helps prevent protein denaturation during freezing and thawing processes. For working solutions, small aliquots can be stored at 4°C for up to one week .

It is crucial to note that repeated freeze-thaw cycles significantly reduce protein stability and activity. Therefore, it is strongly recommended to prepare small, single-use aliquots prior to freezing . When removing the protein from storage, thaw quickly at room temperature or in a water bath at 37°C, then place on ice immediately after thawing to minimize degradation.

What reconstitution methods are recommended for lyophilized UPF0359 membrane protein D1046.5?

Proper reconstitution of lyophilized UPF0359 membrane protein D1046.5 is critical for maintaining structural integrity and functional activity. The following methodological approach is recommended:

  • Briefly centrifuge the vial containing lyophilized protein prior to opening to ensure all material is at the bottom of the tube .

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. The exact concentration should be determined based on the specific experimental requirements .

  • For optimal stability, add glycerol to a final concentration of 5-50%. The standard recommendation is 50% glycerol for maximum stability .

  • Mix gently by inversion or slow pipetting to avoid introducing air bubbles or causing protein denaturation. Do not vortex, as this may lead to protein aggregation.

  • Allow the solution to stand at room temperature for 5-10 minutes to ensure complete solubilization.

  • Aliquot the reconstituted protein into small, single-use volumes to prevent repeated freeze-thaw cycles .

  • For applications requiring membrane protein incorporation into lipid bilayers or detergent micelles, additional steps may be necessary to facilitate proper protein folding and functional reconstitution.

The reconstitution buffer composition may be modified depending on downstream applications, but it is essential to maintain pH stability (typically pH 7.5-8.0) and include appropriate stabilizing agents to preserve protein structure and function.

How can researchers verify the quality and purity of recombinant UPF0359 membrane protein D1046.5?

Rigorous quality control is essential for ensuring reliable experimental results when working with recombinant UPF0359 membrane protein D1046.5. A multi-method approach to quality assessment includes:

SDS-PAGE Analysis:

The most common method for assessing protein purity is SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis). Commercial preparations of recombinant UPF0359 membrane protein D1046.5 typically achieve >85% purity as determined by SDS-PAGE . Researchers should observe a predominant band corresponding to the expected molecular weight of the protein (approximately 50-55 kDa, depending on the tag used).

Western Blot Verification:

For tagged versions of the protein, antibodies against the specific tag (e.g., His-tag) can be used for western blot confirmation. This approach not only verifies the presence of the protein but also confirms that the tag is intact and accessible.

Mass Spectrometry:

For the highest level of verification, mass spectrometry analysis can confirm both the identity and integrity of the recombinant protein. Tryptic digest followed by LC-MS/MS analysis can verify the amino acid sequence and identify any post-translational modifications or truncations.

Functional Assays:

While structural integrity is necessary, functional activity is equally important. Researchers should develop and implement functional assays specific to the predicted activities of UPF0359 membrane protein D1046.5 to ensure that the recombinant protein maintains native-like functionality.

MethodPurposeAcceptance Criteria
SDS-PAGEPurity assessmentSingle predominant band at ~50-55 kDa, >85% purity
Western BlotIdentity confirmationPositive signal with anti-tag antibody
Mass SpectrometrySequence verification>90% sequence coverage, correct MW
Size Exclusion ChromatographyAggregation assessmentPredominant monodisperse peak
Circular DichroismSecondary structure analysisSpectral features consistent with membrane protein

What experimental approaches are suitable for studying UPF0359 membrane protein D1046.5 function?

Due to the uncharacterized nature of UPF0359 membrane protein D1046.5, multiple complementary approaches are recommended to elucidate its function:

Genetic Approaches:

  • CRISPR-Cas9 gene editing - Creating knockout or knockdown C. elegans strains to observe phenotypic changes associated with D1046.5 deficiency.

  • RNA interference (RNAi) - Targeted knockdown of D1046.5 expression to assess functional consequences.

  • Overexpression studies - Expressing the recombinant protein in C. elegans to identify gain-of-function phenotypes.

Biochemical and Structural Analyses:

  • Protein-protein interaction studies - Co-immunoprecipitation, yeast two-hybrid, or proximity labeling approaches to identify interaction partners.

  • Membrane topology mapping - Using protease protection assays or site-directed fluorescence labeling to determine the orientation of the protein within the membrane.

  • Structural characterization - X-ray crystallography or cryo-electron microscopy of purified protein to determine three-dimensional structure.

Cellular Localization:

  • Fluorescent protein tagging - Creating fusion proteins with GFP or other fluorescent tags to track localization in living cells.

  • Immunohistochemistry - Using antibodies against D1046.5 or its tag to visualize distribution in fixed tissues.

  • Subcellular fractionation - Biochemical separation of cellular components to determine which compartments contain D1046.5.

Functional Characterization:

  • Electrophysiology - If the protein is suspected to function as an ion channel or transporter.

  • Transport assays - Measuring movement of potential substrates across membranes in reconstituted systems.

  • Signaling pathway analysis - Examining effects on known signaling cascades when D1046.5 is manipulated.

Each of these approaches provides complementary information that, when integrated, can help elucidate the functional role of this uncharacterized membrane protein in C. elegans biology.

What are common challenges in working with recombinant UPF0359 membrane protein D1046.5 and how can they be addressed?

Working with membrane proteins presents unique challenges due to their hydrophobic nature and structural complexity. Specific challenges with UPF0359 membrane protein D1046.5 include:

Protein Aggregation:

Membrane proteins have a tendency to aggregate due to exposure of hydrophobic domains. To minimize aggregation:

  • Maintain appropriate detergent concentrations above critical micelle concentration

  • Include glycerol (5-50%) in storage buffers

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Consider using amphipols or nanodiscs for stabilization in detergent-free systems

Protein Stability:

The stability of D1046.5 is temperature-sensitive:

  • Store lyophilized protein at -20°C/-80°C for up to 12 months

  • Keep reconstituted protein at -20°C/-80°C with 50% glycerol for up to 6 months

  • Use working aliquots at 4°C for no more than one week

  • Incorporate appropriate protease inhibitors in working solutions

Expression System Compatibility:

E. coli is the reported expression system for recombinant D1046.5 , but researchers should consider:

  • Optimizing codon usage for the expression host

  • Evaluating alternative expression systems (insect cells, yeast) for improved folding

  • Using fusion partners or solubility tags to enhance expression and folding

  • Implementing membrane protein-specific purification strategies

Functional Reconstitution:

For functional studies, proper reconstitution into membrane-mimetic environments is crucial:

  • Test various lipid compositions to identify optimal membrane environment

  • Consider native lipid extracts from C. elegans for more biologically relevant conditions

  • Evaluate different detergents for solubilization and reconstitution

  • Monitor protein orientation during reconstitution to ensure physiological topology

By systematically addressing these challenges through careful optimization, researchers can improve the quality and functionality of recombinant UPF0359 membrane protein D1046.5 preparations for experimental use.

How can researchers analyze potential structural homology of UPF0359 membrane protein D1046.5 with related proteins?

Understanding structural relationships between UPF0359 membrane protein D1046.5 and related proteins can provide valuable insights into potential functions. A systematic approach to homology analysis includes:

Sequence-Based Comparative Analysis:

  • Multiple Sequence Alignment (MSA) - Align D1046.5 with homologs from different species to identify conserved residues and domains.

  • Phylogenetic Analysis - Construct evolutionary trees to understand relationships between D1046.5 and related proteins across species.

  • Motif Identification - Use tools like MEME, PROSITE, or Pfam to identify functional motifs shared with proteins of known function.

Structural Prediction and Comparison:

  • Secondary Structure Prediction - Use algorithms like PSIPRED or JPred to predict secondary structural elements.

  • Transmembrane Topology Prediction - Deploy TMHMM, Phobius, or TOPCONS to predict membrane-spanning regions.

  • 3D Structure Prediction - Utilize AlphaFold2 or RoseTTAFold to generate predicted three-dimensional models.

  • Structural Alignment - Compare predicted or experimental structures with similar proteins using tools like DALI or TM-align.

Functional Domain Analysis:

  • Conserved Domain Analysis - Identify functional domains using CDD, InterPro, or SMART databases.

  • Active Site Prediction - Predict potential catalytic or binding sites based on structural features and conservation patterns.

  • Protein-Protein Interaction Interface Prediction - Identify potential interaction surfaces through computational analysis.

Through this multi-layered approach, researchers can generate testable hypotheses about D1046.5 function based on structural similarities with better-characterized proteins, guiding experimental design for functional validation.

What are emerging research applications for UPF0359 membrane protein D1046.5 in C. elegans biology?

As an uncharacterized protein, UPF0359 membrane protein D1046.5 presents several promising research opportunities:

Developmental Biology:

Investigating the role of D1046.5 in C. elegans development through temporal expression analysis and developmental phenotyping of knockout/knockdown models. The transmembrane nature of this protein suggests potential involvement in intercellular signaling during development or tissue differentiation.

Membrane Biology:

Exploiting D1046.5 as a model system for studying fundamental aspects of membrane protein biogenesis, trafficking, and turnover in a simple multicellular organism with well-characterized cell lineages.

Comparative Genomics:

Utilizing the evolutionary conservation patterns of D1046.5 across nematode species and potential homologs in other phyla to understand the evolution of membrane protein families and their functional diversification.

Systems Biology:

Integrating D1046.5 into protein-protein interaction networks and cellular pathway models in C. elegans to understand its place in the broader context of cellular physiology and potential connections to human disease-related pathways.

Structural Biology:

Employing advanced structural determination techniques like cryo-electron microscopy or X-ray crystallography to solve the three-dimensional structure of D1046.5, contributing to the understanding of UPF family protein structures and potentially revealing novel structural motifs.

These research directions highlight the value of studying uncharacterized proteins like D1046.5 - not only to expand our understanding of C. elegans biology but also to potentially uncover novel cellular mechanisms with broader implications across species.

How can researchers design experiments to elucidate the potential signaling role of UPF0359 membrane protein D1046.5?

If D1046.5 is involved in cellular signaling, a systematic experimental approach could include:

Receptor Function Assessment:

  • Ligand binding assays - Using purified recombinant D1046.5 to screen for potential binding partners from C. elegans lysates or candidate ligand libraries.

  • Signaling pathway activation - Monitoring changes in second messenger levels (cAMP, Ca2+, etc.) in response to D1046.5 stimulation or inhibition.

  • Downstream effector phosphorylation - Examining changes in phosphorylation patterns of potential downstream proteins following D1046.5 activation or deletion.

Genetic Interaction Analysis:

  • Synthetic genetic screens - Identifying genes that, when mutated alongside D1046.5, produce enhanced or suppressed phenotypes.

  • Pathway component knockdowns - Systematically silencing components of known signaling pathways to identify connections with D1046.5 function.

  • Transcriptional profiling - Comparing gene expression patterns between wild-type and D1046.5 mutant worms to identify dysregulated pathways.

Dynamic Localization Studies:

  • Stimulus-dependent trafficking - Tracking the movement of fluorescently-tagged D1046.5 in response to cellular stimuli.

  • Interaction-dependent conformational changes - Using FRET-based biosensors to detect structural alterations upon ligand binding or protein-protein interactions.

  • Lipid raft association - Determining whether D1046.5 localizes to specialized membrane microdomains associated with signaling functions.

Intersectional Approaches:

  • Optogenetic manipulation - Engineering light-responsive variants of D1046.5 to precisely control its activity in specific cells or tissues.

  • Chemogenetic approaches - Creating drug-responsive versions that allow temporal control of D1046.5 function.

  • Cell-specific rescue experiments - Expressing D1046.5 in specific cell types in knockout backgrounds to determine where its function is required.

These experimental strategies, implemented in combination, would provide multiple lines of evidence regarding the potential signaling role of D1046.5 and its place within the cellular signaling network of C. elegans.

What protein tagging strategies are optimal for studying UPF0359 membrane protein D1046.5 localization and interactions?

The choice of protein tagging strategy significantly impacts the success of localization and interaction studies with membrane proteins like D1046.5. Optimal approaches include:

N-terminal vs. C-terminal Tags:

  • Tag position effects - Evaluate both N- and C-terminal tagging to determine which least disrupts membrane topology and function

  • Linker optimization - Incorporate flexible linkers (e.g., GGGGS repeats) between the tag and protein to minimize structural interference

  • Tag size considerations - Smaller tags (His, FLAG) may cause less disruption than larger ones (GFP, mCherry) for functional studies

Recommended Tagging Strategies:

ApplicationRecommended TagAdvantagesConsiderations
PurificationHis6 or Strep-tagEfficient single-step purificationMinimal disruption of structure
ImmunodetectionFLAG or HAHigh-specificity antibodies availableGood sensitivity for low expression
Live imagingSplit-GFPReduced impact on foldingMinimizes trafficking artifacts
Protein interactionsHaloTag or SNAP-tagCompatible with proximity labelingAllows temporal control of labeling
Topology mappingTEV protease sitesEnables determination of cytoplasmic exposureCombined with epitope tags

Site-Specific Labeling Approaches:

For minimal disruption of protein function, consider:

  • Unnatural amino acid incorporation - Using amber suppression to incorporate click chemistry-compatible amino acids at specific positions

  • Enzymatic labeling - Employing sortase-mediated labeling for site-specific modification

  • Minimal tags - Utilizing short peptide sequences recognized by ligases for fluorophore attachment

Native Expression Level Considerations:

To avoid artifacts from overexpression:

  • Genome editing - Using CRISPR-Cas9 to tag the endogenous D1046.5 gene

  • Single-copy integration - Employing MosSCI or similar techniques for controlled expression

  • Inducible systems - Implementing tetracycline-inducible or heat-shock promoters for temporal control

The optimal tagging strategy should be determined empirically for each application, balancing detection sensitivity with preservation of native protein function and localization.

How should researchers interpret and resolve contradictory results in UPF0359 membrane protein D1046.5 studies?

When faced with contradictory results in D1046.5 research, a systematic troubleshooting approach includes:

Experimental System Variability:

  • Expression system differences - Results may vary between heterologous expression (E. coli, yeast, insect cells) and native C. elegans systems. Cross-validate findings across multiple platforms.

  • Tag interference - Different tagging strategies may alter protein function or localization. Compare untagged, N-terminal, and C-terminal tagged versions.

  • Buffer composition effects - Membrane protein behavior is highly sensitive to detergents, salt concentration, and pH. Standardize conditions across experiments.

Methodological Considerations:

  • Assay sensitivity thresholds - Different techniques have varying detection limits. Confirm results using complementary methods with different sensitivity profiles.

  • Time-dependent phenomena - Temporal dynamics may explain apparent contradictions. Implement time-course experiments to capture dynamic processes.

  • Single-molecule vs. ensemble measurements - Population averages may mask heterogeneous behaviors. Consider single-molecule approaches to resolve subpopulations.

Biological Complexity:

  • Isoform-specific effects - Check for alternative splicing or post-translational modifications that might generate functionally distinct protein variants.

  • Cellular context dependence - Function may vary across tissue types or developmental stages. Specify precise experimental conditions and developmental timing.

  • Compensatory mechanisms - Acute vs. chronic protein depletion may yield different phenotypes due to compensation. Compare acute (e.g., auxin-inducible degradation) and chronic (genetic knockout) approaches.

Resolution Strategies:

  • Independent validation - Engage collaborators to reproduce key findings using their established protocols.

  • Hypothesis refinement - Develop more nuanced models that accommodate seemingly contradictory results.

  • Increased biological replication - Expand sample sizes to address potential statistical outliers or biological variability.

  • Control spectrum expansion - Implement additional positive and negative controls to create a more comprehensive interpretative framework.

By systematically addressing these factors, researchers can resolve apparent contradictions and develop a more complete understanding of D1046.5 biology.

What are the most pressing unanswered questions about UPF0359 membrane protein D1046.5?

Despite the availability of tools and reagents for studying UPF0359 membrane protein D1046.5, several fundamental questions remain unanswered:

  • Physiological function - The precise biological role of D1046.5 in C. elegans remains unknown. Determining whether it functions as a receptor, transporter, channel, or structural component is a primary research priority.

  • Interacting partners - Identifying proteins, lipids, or other molecules that interact with D1046.5 would provide crucial insights into its cellular function and pathway involvement.

  • Regulatory mechanisms - Understanding how D1046.5 expression, localization, and activity are regulated during development and in response to environmental stimuli remains unexplored.

  • Structural characteristics - While amino acid sequence is known, the three-dimensional structure, including transmembrane topology and potential functional domains, has not been experimentally determined.

  • Evolutionary significance - The degree of functional conservation between D1046.5 and potential homologs in other species, including mammals, requires investigation to understand its evolutionary importance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.