Recombinant UPF0365 protein STH520 (STH520)

What is UPF0365 protein STH520 and what organism does it originate from?

UPF0365 protein STH520 is a transmembrane protein belonging to the UPF0365 family, originating from the thermophilic bacterium Symbiobacterium thermophilum (strain T / IAM 14863). The protein consists of 332 amino acids with a molecular mass of approximately 35.4 kDa. The designation "UPF" (Uncharacterized Protein Family) indicates that while the protein's structure may be known, its biological function remains to be fully elucidated .

How stable is recombinant UPF0365 protein STH520 under laboratory storage conditions?

Recombinant UPF0365 protein STH520 demonstrates moderate stability under typical laboratory storage conditions. Optimal preservation requires storage at -20°C to -80°C, with liquid formulations maintaining stability for approximately 6 months, while lyophilized preparations can remain stable for up to 12 months. Working aliquots can be maintained at 4°C for up to one week. Importantly, repeated freeze-thaw cycles significantly reduce protein integrity and should be strictly avoided .

What expression systems are optimal for producing recombinant UPF0365 protein STH520?

Multiple expression systems have been successfully employed for the production of recombinant UPF0365 protein STH520, with distinct advantages for specific applications:

E. coli remains the most commonly utilized system due to its cost-effectiveness and high yield potential, particularly for applications not requiring complex post-translational modifications .

What purification strategy yields the highest purity for recombinant UPF0365 protein STH520?

A multistep purification approach is recommended for obtaining high-purity recombinant UPF0365 protein STH520:

• Affinity Chromatography: His-tagged versions can be purified using immobilized metal affinity chromatography (IMAC), typically achieving 70-80% purity in a single step

• Size Exclusion Chromatography: Further purification by gel filtration separates monomeric protein from aggregates and other contaminants

• Ion Exchange Chromatography: Final polishing step to remove remaining impurities

This strategic combination consistently yields preparations with ≥85% purity as determined by SDS-PAGE analysis. For applications requiring exceptionally high purity, additional chromatographic steps may be necessary, though protein yield typically decreases with each additional purification step .

How should researchers design experiments to investigate UPF0365 protein STH520 function?

Designing experiments to elucidate the function of UPF0365 protein STH520 requires a systematic approach:

• Define Research Question: Formulate specific hypotheses about protein function based on sequence analysis, structural predictions, and phylogenetic relationships within the UPF0365 family

• Variable Identification:

  • Independent variables: Experimental conditions (temperature, pH, cofactors)

  • Dependent variables: Measurable outputs (enzymatic activity, binding affinity)

  • Control variables: Factors to be held constant

• Control Implementation:

  • Negative controls: Empty vector expressions, inactivated protein variants

  • Positive controls: Known proteins with similar predicted functions

• Randomization and Blinding: Implement these procedures where appropriate to minimize bias

• Replication Strategy: Plan for both technical and biological replicates to ensure statistical validity

For UPF0365 protein STH520 specifically, comparative analysis with other UPF0365 family proteins and cross-species functional complementation assays may provide valuable insights into its biological role .

What are the most effective methods for detecting protein-protein interactions involving UPF0365 protein STH520?

To investigate protein-protein interactions involving UPF0365 protein STH520, researchers should consider multiple complementary approaches:

For membrane proteins like UPF0365 protein STH520, modified approaches such as membrane yeast two-hybrid or proximity-dependent biotin identification (BioID) may yield more reliable results than conventional interaction assays .

How can researchers effectively analyze the membrane topology of UPF0365 protein STH520?

Analyzing membrane topology of UPF0365 protein STH520 requires specialized techniques:

• Computational Prediction: Initial topology mapping using algorithms like TMHMM, TOPCONS, or Phobius to predict transmembrane regions and orientation

• Biochemical Validation:

  • Selective permeabilization coupled with immunofluorescence

  • Protease protection assays to determine exposed regions

  • Site-directed fluorescence labeling at predicted loops

• Structural Analysis:

  • Cryo-electron microscopy for near-atomic resolution

  • NMR spectroscopy for dynamic information (challenging for full-length protein)

The sequence "MSMPGLGYLILTFVVLLLLVLFFSFVPVGLWISAAAADVRVGIFYMIGM" at the N-terminus strongly suggests a transmembrane region, consistent with computational predictions of multiple membrane-spanning domains .

What spectroscopic methods are optimal for investigating structural changes in UPF0365 protein STH520 under varying conditions?

Several spectroscopic techniques can be employed to monitor structural changes in UPF0365 protein STH520:

• Circular Dichroism (CD) Spectroscopy:

  • Far-UV CD (190-250 nm): Monitors secondary structure changes

  • Near-UV CD (250-350 nm): Detects tertiary structure alterations

• Fluorescence Spectroscopy:

  • Intrinsic tryptophan fluorescence for tertiary structure monitoring

  • ANS binding for hydrophobic exposure analysis

• Fourier Transform Infrared Spectroscopy (FTIR):

  • Particularly useful for membrane proteins

  • Can detect secondary structure changes in lipid environments

• Nuclear Magnetic Resonance (NMR):

  • For detailed structural information at atomic resolution

  • Useful for monitoring protein-ligand interactions

These methods can reveal structural changes occurring in response to temperature, pH, ligand binding, or lipid environment alterations, providing insights into the protein's conformational dynamics and potential functional mechanisms.

What approaches should be used to identify potential enzymatic activities of UPF0365 protein STH520?

As a protein of unknown function, systematic screening for enzymatic activities is recommended:

• Bioinformatic Analysis:

  • Identify conserved domains or motifs that suggest enzymatic function

  • Compare with structurally similar proteins of known function

• Activity Screening:

  • Set up a panel of assays for common enzymatic activities (hydrolase, transferase, oxidoreductase)

  • Design customized assays based on predicted activities

• Metabolomic Approaches:

  • Compare metabolite profiles between wild-type and knockout/overexpression systems

  • Identify metabolic pathways potentially affected by the protein

• Substrate Identification:

  • Activity-based protein profiling with chemical probes

  • Thermal stability shift assays with potential substrates/cofactors

Given the membrane localization, potential transport, signaling, or membrane-associated enzymatic activities should be prioritized in the initial screening .

How can researchers develop valid knockout or knockdown models to study UPF0365 protein STH520 function in Symbiobacterium thermophilum?

Developing genetic manipulation systems for Symbiobacterium thermophilum requires specialized approaches due to its thermophilic nature and unique genetics:

• CRISPR-Cas9 Strategy:

  • Design thermostable Cas9 variants or use Cas proteins from thermophilic organisms

  • Target highly conserved regions of the STH520 gene

  • Include selectable markers suitable for thermophilic growth conditions

• Homologous Recombination Approach:

  • Design constructs with extended homology arms (>1 kb) flanking the target gene

  • Include thermostable selection markers

  • Optimize transformation protocols for efficiency at high temperatures

• Antisense RNA or Ribozyme Strategies:

  • Design thermostable RNA structures targeting STH520 mRNA

  • Express under inducible promoters for controlled knockdown

• Heterologous Complementation:

  • Express STH520 in model organisms where knockout methodology is well-established

  • Test for phenotypic rescue in systems with mutations in homologous genes

Each approach should include appropriate controls to verify knockdown/knockout efficiency and specificity, such as qRT-PCR, Western blotting, and phenotypic rescue experiments with the wild-type gene.

How does UPF0365 protein STH520 compare structurally and functionally with other members of the UPF0365 family?

Comparative analysis reveals important insights about UPF0365 protein STH520 within its protein family:

Structural conservation without clear functional annotation across the UPF0365 family suggests these proteins may perform fundamental cellular functions that remain to be fully characterized .

What techniques are most appropriate for studying thermal stability of UPF0365 protein STH520 compared to mesophilic homologs?

Given the thermophilic origin of UPF0365 protein STH520, analyzing its thermal properties compared to mesophilic homologs requires specialized approaches:

• Differential Scanning Calorimetry (DSC):

  • Provides direct measurement of thermal transition temperatures

  • Determines enthalpy changes during unfolding

• Thermofluor Assays:

  • High-throughput screening of thermal stability

  • Can test multiple buffer conditions simultaneously

• Circular Dichroism with Temperature Ramping:

  • Monitors secondary structure changes during thermal denaturation

  • Can determine cooperativity of unfolding

• Activity Assays at Different Temperatures:

  • Functional approach to determine temperature optima

  • Establishes temperature range for biological activity

• Molecular Dynamics Simulations:

  • Computational prediction of thermal stability

  • Identifies key stabilizing interactions

These comparative analyses may reveal structural features that contribute to thermostability, potentially informing protein engineering applications seeking to enhance stability of mesophilic proteins .