Recombinant UPF0382 inner membrane protein ygdD (ygdD)

What is UPF0382 inner membrane protein ygdD and what organisms express it?

UPF0382 inner membrane protein ygdD is a bacterial protein primarily found in Escherichia coli strains. It is classified as an inner membrane protein with currently uncharacterized function (UPF designation indicates "uncharacterized protein family"). The protein is expressed in multiple E. coli strains, including E. coli O157:H7 (UniProt accession: P0ADR4) and E. coli O6 (UniProt accession: P0ADR3) . The full-length protein consists of 131 amino acid residues and contains multiple transmembrane domains typical of integral membrane proteins. The protein is encoded by the ygdD gene, which appears in different E. coli strains with locus names such as Z4124, ECs3667 (for O157:H7 strain) and c3377 (for O6 strain) .

What are the optimal storage conditions for recombinant UPF0382 inner membrane protein ygdD?

For optimal stability and retention of biological activity, recombinant UPF0382 inner membrane protein ygdD should be stored according to this protocol:

• Long-term storage: Maintain at -20°C or preferably -80°C for extended preservation

• Working conditions: Store aliquots at 4°C for up to one week when actively using the protein

• Buffer composition: The protein is typically provided in a Tris-based buffer with 50% glycerol optimized for stability

• Avoid freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may compromise protein integrity and activity

• Aliquoting: When receiving the stock, prepare small working aliquots to prevent repeated freeze-thaw cycles

These conditions apply to the recombinant protein regardless of its expression system origin (E. coli, yeast, baculovirus, or mammalian cells).

How should researchers verify the identity and integrity of recombinant UPF0382 inner membrane protein ygdD?

To confirm the identity and integrity of recombinant UPF0382 inner membrane protein ygdD, researchers should implement the following verification protocol:

• SDS-PAGE analysis: Run the protein on a gel to confirm its molecular weight (expected ~14 kDa for the core protein, plus any tag additions)

• Western blotting: Use anti-tag antibodies if the protein contains affinity tags, or develop specific antibodies against the protein

• Protein sequencing: Perform N-terminal sequencing to confirm the expected amino acid sequence: MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLEYQAFHTLAILGLAVA...

• Mass spectrometry: Confirm the exact mass and potential post-translational modifications

• Circular dichroism (CD): Analyze secondary structure components which should reflect the predominantly α-helical nature of this membrane protein

What expression systems are available for producing recombinant UPF0382 inner membrane protein ygdD?

Recombinant UPF0382 inner membrane protein ygdD can be produced in multiple expression systems, each offering distinct advantages for different research applications:

Additionally, specialized versions such as biotinylated variants (e.g., CSB-EP365020EGX1-B with Avi-tag) are available for specialized applications like protein-protein interaction studies and immobilization experiments . The selection of an appropriate expression system should be determined by the specific research objectives and downstream applications.

What experimental approaches are recommended for studying the membrane topology of UPF0382 inner membrane protein ygdD?

For elucidating the membrane topology of UPF0382 inner membrane protein ygdD, researchers should consider implementing a multi-technique approach:

• Cysteine scanning mutagenesis: Systematically replace individual amino acids with cysteine residues throughout the protein sequence, then perform accessibility labeling with membrane-permeant and impermeant thiol-reactive reagents to determine which regions are exposed to the cytoplasm versus periplasm.

• GFP-fusion analysis: Create strategic fusions with GFP at various positions within the protein sequence. The fluorescence will only develop if the GFP domain is properly folded in the cytoplasm, providing topological information.

• Protease protection assays: Expose membrane preparations containing the protein to proteases in the presence or absence of membrane permeabilization agents. Compare the resulting digestion patterns by immunoblotting to determine which regions are protected by the membrane.

• Computational prediction validation: Use the amino acid sequence (MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLEYQAFHTLAILGLAVA MQRRISIW FYWSSVFLALGTVLFSGSLYC LALSHLRLWAFVTPVGGVSFLAGYWALMLVGA IRLKRKGVSHE) to generate topology predictions with tools like TMHMM or TOPCONS, then experimentally validate these predictions .

The experimental design should include appropriate controls and replicate determinations to ensure reliable results. Findings can be compared with known membrane proteins of similar structure from the same organism to build more robust topological models.

How can researchers design experiments to identify potential binding partners of UPF0382 inner membrane protein ygdD?

To systematically identify potential binding partners and functional interactions of UPF0382 inner membrane protein ygdD, researchers should implement the following experimental design strategy:

• Co-immunoprecipitation with tandem mass spectrometry (Co-IP/MS):

  • Express tagged versions of ygdD protein in E. coli

  • Solubilize membrane fractions with appropriate detergents

  • Perform immunoprecipitation using anti-tag antibodies

  • Identify co-precipitating proteins via LC-MS/MS

  • Validate interactions through reciprocal Co-IP experiments

• Bacterial two-hybrid system analysis:

  • Create fusion constructs of ygdD with DNA-binding domains

  • Screen against a genomic library of E. coli

  • Quantify interaction strength through reporter gene expression

  • Confirm positive hits through secondary assays

• Proximity-dependent biotin labeling (BioID approach):

  • Generate fusion proteins of ygdD with a biotin ligase (BirA*)

  • Express in native conditions to biotinylate proximal proteins

  • Purify biotinylated proteins using streptavidin

  • Identify labeled proteins through proteomics

• Surface Plasmon Resonance (SPR) screening:

  • Immobilize purified biotinylated ygdD protein (available as CSB-EP365020EGX1-B) on a streptavidin sensor chip

  • Flow E. coli extracts or purified candidate proteins over the surface

  • Measure binding kinetics and affinities of interacting partners

These approaches should be executed using both wild-type and mutant versions of the protein to identify binding domains and critical interaction residues. The experimental design must include randomization of samples and appropriate controls to minimize bias, as described in experimental design methodology .

What considerations should guide the design of knockout/complementation studies for functional characterization of the ygdD gene?

When designing knockout/complementation studies for functional characterization of the ygdD gene, researchers should implement this systematic experimental framework:

• Generation of clean deletion mutants:

  • Use Lambda Red recombination or CRISPR-Cas9 to create markerless deletions of ygdD

  • Confirm deletions by PCR and sequencing of the genomic region

  • Verify absence of polar effects on adjacent genes through RT-qPCR

• Phenotypic characterization strategy:

  • Design a multi-parameter assessment including:

    • Growth curves in various media compositions

    • Membrane integrity assays (detergent sensitivity, permeability dyes)

    • Stress response profiling (osmotic, oxidative, pH, temperature)

    • Biofilm formation capacity

    • Metabolite profiling using targeted metabolomics

• Complementation construct design:

  • Create expression vectors with ygdD under native promoter control

  • Develop a series of point-mutant complementation constructs targeting conserved residues

  • Include epitope-tagged versions for localization studies

  • Use inducible promoters for dose-dependent complementation analysis

• Controls and validation:

  • Include parental wild-type strain in all experiments

  • Generate mock-complemented strains (empty vector controls)

  • Perform genetic complementation under multiple growth conditions

  • Quantify ygdD expression levels in complemented strains relative to wild-type

• Analysis framework:

  • Apply statistical methods appropriate for experimental design type

  • Implement randomization and blinding where possible

  • Use technical and biological replicates (minimum n=3)

  • Calculate effect sizes and confidence intervals

This experimental design enables robust assignment of function by comparing deletion phenotypes with complementation outcomes while controlling for potential confounding factors, thereby establishing causal relationships between genotype and phenotype.

How can researchers effectively design experiments to study the structure-function relationship of UPF0382 inner membrane protein ygdD?

To systematically investigate structure-function relationships of UPF0382 inner membrane protein ygdD, implement this integrated experimental approach:

• Strategic mutagenesis design:

  • Perform alanine-scanning mutagenesis across all 131 amino acids

  • Create targeted mutations in predicted functional motifs

  • Design chimeric proteins with homologs from other bacteria

  • Generate truncation mutants to identify essential domains

  • Focus on conserved residues identified through sequence alignment of ygdD homologs

• Expression and localization validation:

  • Verify all mutant constructs for expression levels comparable to wild-type

  • Confirm proper membrane localization using fractionation techniques

  • Assess protein stability through pulse-chase experiments

  • Employ fluorescent fusions to visualize subcellular distribution

• Functional assays based on phenotypic observations:

  • Develop quantitative assays based on knockout phenotypes

  • Measure membrane potential using fluorescent probes

  • Assess ion flux capabilities using reconstituted proteoliposomes

  • Evaluate protein-protein interactions through co-IP or FRET-based methods

• Structural analysis integration:

  • Correlate functional data with structural information

  • Use site-directed spin labeling and EPR spectroscopy for dynamic information

  • Apply computational modeling to predict effects of mutations

  • Implement hydrogen-deuterium exchange mass spectrometry to identify flexible regions

• Data analysis framework:

  • Create comprehensive mutation-function maps

  • Employ factorial experimental design to assess interaction effects between mutations

  • Use hierarchical clustering to identify functional domains

  • Visualize structure-function relationships through heatmaps

This systematic approach allows researchers to correlate specific structural elements with functional properties, providing deeper insights into the mechanistic basis of ygdD protein function in bacterial membranes.

How should researchers design control experiments when working with recombinant UPF0382 inner membrane protein ygdD?

When designing experiments with recombinant UPF0382 inner membrane protein ygdD, implement these comprehensive control strategies to ensure valid and reproducible results:

• Protein-specific controls:

  • Negative control: Use a similarly sized non-related membrane protein expressed and purified under identical conditions

  • Denatured control: Include samples of heat-denatured ygdD protein to distinguish between specific and non-specific effects

  • Tag-only control: Express and purify the tag portion alone without the ygdD protein to account for tag interference

  • Expression system control: Compare proteins expressed in different systems (e.g., E. coli vs. mammalian) to identify system-specific artifacts

• Experimental validity controls:

  • Technical replicates: Perform at least three independent experiments with freshly prepared protein preparations

  • Concentration gradients: Test multiple concentrations of the protein to establish dose-dependent relationships

  • Time course analysis: Examine time-dependent effects to distinguish between primary and secondary consequences

  • Randomization: Randomize the order of sample processing to minimize batch effects

• Assay-specific controls:

  • Positive control: Include a well-characterized membrane protein with known activity

  • Buffer control: Test effects of the buffer components (Tris, glycerol) without protein

  • Instrument calibration standards: Use appropriate standards for the specific analytical technique

• Validation strategy:

  • Confirm key findings using orthogonal methods

  • Verify recombinant protein activity before and after experimental procedures

  • Include wild-type bacterial strains alongside recombinant protein experiments

What statistical considerations should guide experiments investigating UPF0382 inner membrane protein ygdD function?

When designing experiments to investigate UPF0382 inner membrane protein ygdD function, researchers should implement these statistical considerations to ensure robust, reproducible results:

• Experimental design planning:

  • Sample size determination: Conduct power analysis prior to experimentation, typically aiming for 80-90% power to detect biologically relevant effect sizes

  • Randomization strategy: Employ complete randomization for simple designs or blocked randomization for complex multi-factor experiments

  • Factorial designs: Consider full or fractional factorial designs when studying multiple variables (e.g., mutations, conditions, time points) to efficiently detect interaction effects

  • Latin square designs: Use when testing multiple conditions with potential order effects

• Appropriate statistical tests selection:

  • Parametric vs. non-parametric: Verify data normality using Shapiro-Wilk test; choose non-parametric alternatives when assumptions are violated

  • Multiple comparison corrections: Apply Bonferroni or false discovery rate (FDR) methods when performing multiple parallel tests

  • Mixed-effects models: Implement when incorporating both fixed effects (e.g., protein variants) and random effects (e.g., batch variation)

• Data quality assessment:

  • Outlier detection: Use Grubbs' test or Dixon's Q-test for identification of statistical outliers

  • Technical variation quantification: Calculate coefficients of variation for technical replicates (target <15%)

  • Biological replication: Ensure minimum of 3-5 independent biological replicates

• Advanced analytical considerations:

  • Bayesian approaches: Consider when prior knowledge about protein function exists

  • Multivariate analysis: Apply principal component analysis (PCA) or clustering when measuring multiple parameters

  • Effect size reporting: Include Cohen's d, odds ratios, or percent changes alongside p-values

  • Confidence intervals: Report 95% confidence intervals for all primary measurements

These statistical guidelines ensure that experiments with ygdD protein produce reliable, interpretable results while minimizing both Type I and Type II errors in hypothesis testing.

How can researchers design experiments to differentiate between direct and indirect effects when studying UPF0382 inner membrane protein ygdD?

To differentiate between direct and indirect effects when studying UPF0382 inner membrane protein ygdD, researchers should implement this multi-layered experimental design strategy:

This comprehensive strategy allows researchers to establish causal relationships by demonstrating both necessity and sufficiency of ygdD for observed effects, while controlling for indirect consequences through temporal and spatial resolution approaches.

How should researchers approach contradictory results when studying the function of UPF0382 inner membrane protein ygdD?

When faced with contradictory results in UPF0382 inner membrane protein ygdD research, implement this systematic resolution framework:

• Technical validation phase:

  • Reagent authentication: Verify protein identity through mass spectrometry or sequencing

  • Method standardization: Develop standard operating procedures (SOPs) for key assays

  • Cross-laboratory validation: Collaborate with independent labs to replicate critical experiments

  • Blind analysis: Have data analyzed by researchers unaware of expected outcomes

  • Alternative technique application: Confirm findings using methodologically distinct approaches

• Experimental conditions assessment:

  • Microenvironment examination: Document and control all experimental variables (pH, temperature, salt concentration)

  • Strain background effects: Test in multiple E. coli genetic backgrounds

  • Growth condition matrix: Systematically vary media composition and growth phases

  • Protein conformation states: Consider potential oligomeric states or conformational heterogeneity

• Context-dependent function analysis:

  • Interactome mapping: Determine if contradictions arise from different protein interaction networks

  • Post-translational modification profiling: Identify condition-specific modifications

  • Membrane composition effects: Examine lipid dependence of protein function

  • Stress response integration: Evaluate function under various cellular stress conditions

• Data integration approach:

  • Meta-analysis framework: Apply formal statistical methods to integrate contradictory datasets

  • Bayesian belief updating: Integrate prior knowledge with new evidence systematically

  • Systems biology modeling: Develop computational models that can reconcile apparently contradictory observations

  • Research synthesis: Produce comprehensive review of contradictory findings with potential explanations

This approach transforms contradictory results from obstacles into opportunities for deeper mechanistic understanding, potentially revealing condition-specific functions or regulatory mechanisms of ygdD protein.

What are the key considerations for interpreting protein-protein interaction data involving UPF0382 inner membrane protein ygdD?

When interpreting protein-protein interaction data for UPF0382 inner membrane protein ygdD, researchers should apply these critical analytical frameworks:

• Technical validity assessment:

  • Detection method limitations: Evaluate inherent biases in techniques used (Y2H, Co-IP, crosslinking)

  • Expression level artifacts: Determine if interactions are influenced by non-physiological protein concentrations

  • Detergent effects: Assess how membrane solubilization conditions might alter native interactions

  • Tag interference: Compare data from differently tagged versions (N-terminal vs. C-terminal) and tag-free approaches

  • Signal-to-noise ratios: Establish clear thresholds for distinguishing specific from non-specific interactions

• Biological significance evaluation:

  • Co-localization confirmation: Verify that interacting proteins share subcellular localization in vivo

  • Co-expression analysis: Determine if interacting proteins are expressed under similar conditions

  • Evolutionary conservation: Assess if interactions are conserved across bacterial species

  • Interaction specificity: Test interactions with closely related proteins to determine selectivity

  • Conditional dependency: Examine if interactions change under different physiological conditions

• Functional relevance determination:

  • Interaction-dead mutants: Generate specific mutations that disrupt interaction without affecting folding

  • Phenotypic concordance: Compare phenotypes of ygdD mutants with those of interaction partner mutants

  • Epistasis analysis: Determine genetic relationships between ygdD and partner genes

  • Biochemical activity effects: Measure how interactions influence specific activities of either protein

• Data integration strategy:

  • Interaction network mapping: Position findings within the broader E. coli membrane protein interactome

  • Domain-based interaction modeling: Identify specific regions involved in different interactions

  • Dynamic interaction profiling: Characterize temporal aspects of interactions under changing conditions

  • Quantitative binding parameters: Compare affinities and kinetics across different interaction partners

These analytical approaches enable researchers to distinguish functionally significant interactions from technical artifacts and to construct mechanistic models explaining the biological roles of ygdD interactions.

How can researchers apply structural biology techniques to study UPF0382 inner membrane protein ygdD?

To elucidate the structural characteristics of UPF0382 inner membrane protein ygdD, researchers should implement this comprehensive structural biology strategy:

These methods should be applied in combination, as each technique provides complementary information. The resulting structural data will provide insights into the functional mechanisms of ygdD and guide rational design of experiments to probe structure-function relationships.

How can researchers design experiments to investigate the potential role of UPF0382 inner membrane protein ygdD in bacterial stress responses?

To systematically investigate the potential role of UPF0382 inner membrane protein ygdD in bacterial stress responses, implement this comprehensive experimental design framework:

• Stress response profiling:

  • Transcriptional analysis: Compare wild-type and ΔygdD mutant transcriptomes under multiple stress conditions:

    • Oxidative stress (H₂O₂, paraquat)

    • Membrane stress (ethanol, detergents)

    • pH stress (acidic and alkaline conditions)

    • Osmotic stress (high salt, high sucrose)

    • Temperature stress (heat shock, cold shock)

  • Proteomics approach: Perform quantitative proteomics to identify differences in stress response proteins

  • Metabolomic assessment: Profile metabolic changes in response to stress

  • Growth phenotyping: Create stress response curves measuring growth parameters under varying stress intensities

• Molecular mechanism investigation:

  • Protein modification analysis: Examine post-translational modifications of ygdD under stress conditions

  • Protein-protein interaction shifts: Map condition-dependent interactome changes

  • Subcellular localization dynamics: Track ygdD distribution changes during stress responses

  • Membrane integrity measurements: Assess membrane potential, permeability, and fluidity

• Genetic interaction studies:

  • Synthetic genetic array: Screen for genetic interactions with known stress response genes

  • Epistasis analysis: Position ygdD within known stress response pathways

  • Suppressor screening: Identify mutations that suppress stress sensitivity in ΔygdD mutants

  • Conditional essentiality testing: Determine if ygdD becomes essential under specific stress conditions

• Biochemical function characterization:

  • Membrane property alterations: Measure effects on membrane physical characteristics

  • Ion flux measurements: Assess potential role in ion homeostasis during stress

  • Protein stability determinations: Examine if ygdD stabilizes membrane proteins under stress

  • Lipidomic analysis: Profile lipid composition changes dependent on ygdD function

• Experimental design principles application:

  • Factorial design: Implement to test interactions between different stressors

  • Dose-response curves: Establish for each stressor with and without ygdD

  • Time-course experiments: Distinguish between immediate and adaptive responses

  • Control inclusion: Use well-characterized stress response mutants as benchmarks

This systematic approach will elucidate whether ygdD plays a direct role in stress sensing, signal transduction, or adaptation mechanisms, contextualizing its function within bacterial stress response networks.

What are the most promising future research directions for understanding UPF0382 inner membrane protein ygdD function?

The study of UPF0382 inner membrane protein ygdD presents several promising research avenues that could significantly advance understanding of bacterial membrane biology. Future research should focus on these high-priority directions:

• Integrative multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics data from ygdD mutants across diverse conditions will likely reveal functional patterns not apparent through individual techniques. This systems biology approach can position ygdD within broader cellular networks and identify condition-specific functions.

• Evolutionary functional analysis: Comparing ygdD orthologs across bacterial species would illuminate conserved versus species-specific functions. Particular attention should be paid to pathogenic versus non-pathogenic strains to determine if ygdD contributes to virulence-related membrane adaptations.

• High-resolution structural studies: Determining the three-dimensional structure of ygdD in different conformational states will provide mechanistic insights into its function. Cryo-electron microscopy and integrative structural biology approaches are particularly promising given the challenges of membrane protein crystallization.

• In vivo dynamics investigation: Developing methods to track ygdD behavior in living cells using advanced microscopy techniques would reveal dynamic aspects of its function, potentially identifying transient interactions or condition-dependent localization patterns.

• Biochemical activity identification: Focused efforts to identify specific biochemical activities (e.g., ion transport, lipid modification, protein chaperoning) through reconstitution in defined lipid environments could definitively establish ygdD's molecular function .

The integration of these approaches, combined with rigorous experimental design and appropriate controls, promises to transform our understanding of this currently uncharacterized membrane protein and potentially reveal new paradigms in bacterial membrane biology.