Recombinant UPF0392 protein R07B7.12 (R07B7.12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may be used as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
R07B7.12; Glycosyltransferase family 92 protein R07B7.12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-550
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
R07B7.12
Target Protein Sequence
MGNFSFTMFQILNLKMNLSLPYCNRSTGRICSKIRLYHRSFRSNPSLQMCFIIVFLLFIF SLIMFMKLNQNSYSGKEILGYLYETAIDQLTYNHTHAFITSAYYYRNSKSLGENAVAMIV AMSQRTFKHLENHEITIVGSRGYQNLKTKASITVETAEQMSCEYVMALIQGITLEIPQKL EIESAGTRVQIPFREPRKNSHSPVIICISPQFVAEKWQLFLMNIHVIRRYGGHMHIYITS MVEKLFNVLKIYEDMEALTIDYWIRMKLKKTSSPVADIMKNVEWRHQAGAQTDCLLQYKE VAEFIAFFDIDDILVPNFSHNYHQEFSSHFNAYPSYHSIFYGKRDVFVEKISSIEDFSFR HLFSNMKIQEETGYGKSIVNPLKYNSTWIHHSMKLPRNKMLKIMNTEIIHIKNILDSELN KDAPIHLPIIYGTETESVIREMDLKTLDFDFQTVYQNPIYREAALKMIDYNFYTPIVFNC YNESFYHPYFVEKKDFSQICPNADNCQLPQREDIKCIHSDGEYVSGPEMYPITFHYAVHP FWSNDIGCYQ
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_R07B7.12

UniGene: Cel.2868

Protein Families
Glycosyltransferase 92 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UPF0392 protein R07B7.12 and what organism does it originate from?

UPF0392 protein R07B7.12 is a protein encoded by the R07B7.12 gene in Caenorhabditis elegans, a nematode worm commonly used as a model organism in biological research. This protein belongs to the UPF0392 family, where "UPF" designates proteins with "uncharacterized protein family" status, indicating that its functional characterization remains incomplete. The protein consists of 550 amino acids in its full-length form and is identified by the UniProt accession number Q21802 . The designation "R07B7.12" refers to the specific open reading frame (ORF) location within the C. elegans genome.

What are the optimal storage conditions for recombinant R07B7.12 protein?

For optimal stability and activity maintenance of recombinant R07B7.12 protein, storage should follow these research-validated guidelines:

  • The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized specifically for this protein's stability characteristics .

  • For long-term storage, keep the protein at -20°C or preferably at -80°C for extended preservation of activity and structural integrity .

  • For working solutions, store aliquots at 4°C for up to one week to maintain functional properties while minimizing freeze-thaw damage .

  • Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein structure and function. It is strongly recommended to prepare single-use aliquots during initial sample processing .

  • When utilizing the protein for assays, allow it to equilibrate to room temperature gradually before opening the container to prevent condensation that could affect protein concentration and stability.

What expression systems are most effective for producing recombinant R07B7.12 protein?

Based on current research practices, E. coli represents the predominant expression system for recombinant R07B7.12 protein production, offering several methodological advantages:

E. coli expression systems successfully produce full-length (1-550 amino acids) recombinant R07B7.12 protein with appropriate tagging strategies such as His-tagging for purification purposes . The bacterial expression provides high yield and relative ease of purification when compared to more complex eukaryotic systems.

For researchers requiring optimal expression, consider these methodological aspects:

  • Codon optimization: Since C. elegans and E. coli have different codon usage preferences, codon optimization of the R07B7.12 sequence for E. coli expression can significantly improve protein yield.

  • Fusion tag selection: While His-tags are commonly used, other fusion partners (GST, MBP) may improve solubility if expression yields insoluble protein. The tag position (N or C-terminal) should be carefully considered based on structural predictions to avoid interfering with protein folding.

  • Expression conditions: Optimization of induction parameters (temperature, IPTG concentration, induction time) is critical for maximizing functional protein yield while minimizing inclusion body formation.

  • Lysis and purification strategy: Development of an optimized buffer system containing appropriate detergents or solubilizing agents might be necessary if membrane association is suspected based on sequence analysis.

What purification methods are recommended for obtaining high-purity R07B7.12 protein?

A multi-step purification strategy is recommended for obtaining high-purity R07B7.12 protein suitable for structural and functional studies:

  • Affinity Chromatography: For His-tagged R07B7.12 protein, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides effective initial purification. Loading conditions should include 10-20 mM imidazole to minimize non-specific binding, followed by step or gradient elution with increasing imidazole concentration (typically 250-300 mM for elution) .

  • Ion Exchange Chromatography: Based on the theoretical pI calculated from the amino acid sequence, select appropriate ion exchange resin (cation or anion exchange) as a second purification step to remove contaminants with different charge properties.

  • Size Exclusion Chromatography: As a final polishing step, gel filtration separates the target protein from aggregates and smaller contaminants while also providing information about the oligomeric state of the purified protein.

  • Quality Control: Assess purity using SDS-PAGE (>95% for most applications), Western blotting for identity confirmation, and mass spectrometry for accurate molecular weight determination and potential post-translational modifications.

  • Activity Verification: While specific functional assays for R07B7.12 are not well-established due to its uncharacterized nature, general protein quality assessments such as circular dichroism for secondary structure content and thermal stability measurements are recommended.

How can I design experiments to investigate potential binding partners of R07B7.12?

Investigating protein-protein interactions for uncharacterized proteins like R07B7.12 requires a systematic approach combining multiple complementary methods:

  • Pull-down Assays: Using purified His-tagged R07B7.12 as bait, perform pull-down experiments with C. elegans lysates followed by mass spectrometry identification of co-precipitated proteins. Include appropriate controls using unrelated His-tagged proteins to identify non-specific interactions .

  • Yeast Two-Hybrid Screening: Construct R07B7.12 bait vectors and screen against C. elegans cDNA libraries. Consider both full-length protein and domain-specific constructs to avoid potential issues with membrane associations that might interfere with nuclear localization required for Y2H systems.

  • Co-Immunoprecipitation: Develop specific antibodies against R07B7.12 or use epitope-tagged versions expressed in C. elegans to perform co-IP experiments from native tissues, identifying physiologically relevant interaction partners.

  • Proximity Labeling: Express R07B7.12 fused to enzymes like BioID or APEX2 in C. elegans to identify proteins in close proximity in vivo, providing spatial context for potential interactions.

  • Bioinformatic Prediction: Utilize computational approaches including:

    • Sequence-based interaction predictions

    • Co-expression analysis using C. elegans transcriptomic datasets

    • Evolutionary conservation patterns that might suggest functional relationships

  • Validation Strategy: Confirm identified interactions through reciprocal pull-downs, functional assays, and co-localization studies in C. elegans.

What are the challenges in determining the three-dimensional structure of R07B7.12 protein?

Structural characterization of UPF0392 protein R07B7.12 presents several methodological challenges that researchers should consider when planning structural biology investigations:

  • Membrane Association Prediction: Sequence analysis suggests potential membrane association regions which may complicate expression, purification, and crystallization processes. The amino acid sequence contains hydrophobic stretches that might represent transmembrane domains or membrane-association regions .

  • Protein Stability Issues: Uncharacterized proteins often present stability challenges during purification and crystallization. Stability screening using differential scanning fluorimetry (thermofluor) is recommended to identify buffer conditions that maximize thermal stability.

  • Crystallization Barriers: Several approaches may overcome crystallization difficulties:

    • Limited proteolysis to identify stable domains suitable for crystallization

    • Surface entropy reduction (SER) through mutation of surface residues with high conformational entropy

    • Co-crystallization with binding partners or ligands if identified

    • Fusion with crystallization chaperones like T4 lysozyme or BRIL

  • NMR Spectroscopy Considerations: If pursuing NMR studies:

    • Size limitations (R07B7.12 at 550 amino acids exceeds typical size limits for traditional NMR)

    • Isotopic labeling strategies (15N, 13C, 2H) are essential

    • Domain identification and construct optimization may be necessary for tractable studies

  • Cryo-EM Approach: For full-length structural determination, cryo-EM represents a viable alternative that avoids crystallization requirements, though the relatively small size of R07B7.12 (approximately 60 kDa) approaches the lower size limit for conventional cryo-EM studies.

How can functional characterization of R07B7.12 be approached given its uncharacterized status?

Systematic functional characterization of UPF0392 protein R07B7.12 requires an integrative approach combining genetic, biochemical, and computational strategies:

  • Reverse Genetics in C. elegans:

    • CRISPR/Cas9 knockout or knockdown studies to assess phenotypic consequences

    • Generation of conditional alleles to overcome potential lethality issues

    • Tissue-specific silencing to identify primary sites of function

    • Fluorescent tagging for subcellular localization studies

  • Biochemical Activity Screening:

    • Systematic testing for enzymatic activities (kinase, phosphatase, protease, nuclease activities)

    • Binding assays with common cofactors (nucleotides, metal ions, lipids)

    • Metabolite profiling comparing wild-type and mutant worms

  • Computational Functional Prediction:

    • Structural homology modeling based on remote homologs

    • Identification of conserved catalytic or binding motifs

    • Evolutionary analysis across species to identify functional constraints

  • Interactome Mapping:

    • Constructing protein-protein interaction networks centered on R07B7.12

    • Integration with existing C. elegans interaction datasets

    • Correlation analysis with co-expressed genes

  • Phenotypic Profiling:

    • Detailed characterization of mutant phenotypes under various stress conditions

    • Lifespan, development, and reproduction assessments

    • Behavioral assays to detect neurological involvement

How can post-translational modifications of R07B7.12 be identified and characterized?

Comprehensive characterization of post-translational modifications (PTMs) in R07B7.12 requires a multi-faceted mass spectrometry-based approach:

  • Sample Preparation Strategies:

    • Expression and purification of recombinant R07B7.12 from multiple expression systems (bacterial, insect, mammalian) to capture diverse modification patterns

    • Isolation of native R07B7.12 from C. elegans under different physiological conditions to identify condition-specific modifications

    • Enrichment methods for specific PTM types (phosphorylation, glycosylation, etc.)

  • Mass Spectrometry Analysis Pipeline:

    • Multiple proteolytic digestions (trypsin, chymotrypsin, Glu-C) to ensure comprehensive sequence coverage

    • High-resolution LC-MS/MS analysis using collision-induced dissociation (CID), higher-energy collisional dissociation (HCD), and electron transfer dissociation (ETD) fragmentation methods

    • Targeted analysis of predicted modification sites based on sequence motifs

  • Bioinformatic Analysis:

    • PTM site prediction using algorithms specific for phosphorylation (NetPhos), glycosylation (NetNGlyc), acetylation, and other common modifications

    • Conservation analysis of potential PTM sites across species

    • Integration with structural predictions to assess surface accessibility of modification sites

  • Functional Validation:

    • Site-directed mutagenesis of identified PTM sites to assess functional impact

    • Generation of modification-specific antibodies for temporal and spatial studies

    • Identification of enzymes responsible for the modifications through candidate approach or proteome-wide screens

  • Quantitative Analysis:

    • SILAC or TMT labeling to quantify modification stoichiometry under different conditions

    • Targeted quantitative assays (MRM/PRM) for monitoring specific modifications in response to stimuli

How can protein aggregation issues be addressed when working with recombinant R07B7.12?

Protein aggregation is a common challenge when working with recombinant proteins, particularly those with hydrophobic regions like R07B7.12. Implementing these methodological strategies can help overcome aggregation issues:

  • Expression Optimization:

    • Reduce expression temperature (16-20°C) during induction to slow protein synthesis and allow proper folding

    • Decrease inducer concentration to reduce expression rate

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J, trigger factor) to assist folding

    • Consider low-copy number expression vectors to moderate expression levels

  • Solubilization Strategies:

    • Screen detergents for membrane-associated regions (starting with mild detergents like DDM, CHAPS, or Brij-35)

    • Test co-solutes that promote protein stability (arginine, proline, polyols)

    • Evaluate the effect of salt concentration (typically 100-500 mM NaCl) and pH variations

    • Consider fusion partners known to enhance solubility (MBP, SUMO, thioredoxin) with appropriate protease sites for removal

  • Buffer Optimization:

    • Perform systematic buffer screening using techniques like differential scanning fluorimetry

    • Include stabilizing agents like glycerol (10-20%) or specific cofactors

    • Test reducing agents (DTT, TCEP) if cysteine oxidation contributes to aggregation

    • Consider additives that prevent non-specific interactions (low concentrations of SDS or urea)

  • Purification Approaches:

    • Incorporate size exclusion chromatography as a critical step to separate monomeric protein from aggregates

    • Consider on-column refolding protocols if inclusion body purification is necessary

    • Use gradient elution methods to minimize local concentration effects that promote aggregation

    • Maintain protein concentration below aggregation threshold during all steps

What controls should be included in binding studies involving R07B7.12?

Robust experimental design for R07B7.12 binding studies requires comprehensive controls to establish specificity and physiological relevance:

  • Negative Controls:

    • Unrelated proteins with similar properties (size, pI, tags) to distinguish specific interactions

    • Tag-only constructs to identify tag-mediated interactions

    • Denatured R07B7.12 to control for non-specific hydrophobic interactions

    • Buffer-only conditions to establish baseline signals in binding assays

  • Specificity Controls:

    • Competition assays with unlabeled protein to verify binding site specificity

    • Truncated or domain-specific constructs to map interaction domains

    • Site-directed mutants targeting predicted interaction interfaces

    • Titration series to determine binding affinity constants and saturation points

  • Technical Controls:

    • Multiple detection methods to confirm interactions (e.g., ELISA, SPR, MST, ITC)

    • Reversal of bait-prey orientation in pull-down or co-immunoprecipitation experiments

    • Reciprocal tagging strategies to ensure tag position does not interfere with binding

    • Pre-clearing lysates to reduce non-specific binding to resins or antibodies

  • Biological Relevance Controls:

    • Verification of co-expression in the same tissues or subcellular compartments

    • Confirmation that binding occurs under physiologically relevant conditions (pH, ionic strength)

    • Correlation of binding with functional outcomes in C. elegans

    • Evolutionary conservation analysis of the interaction interface

How can protein yield and purity be optimized for structural studies of R07B7.12?

Structural studies require exceptional protein quality in terms of both purity and conformational homogeneity. For R07B7.12, consider these optimization strategies:

  • Expression Yield Enhancement:

    • Systematic screening of expression strains (BL21(DE3), BL21(DE3)pLysS, Rosetta, ArcticExpress)

    • Optimization of culture media (rich media, auto-induction, minimal media for isotopic labeling)

    • Induction parameter optimization (OD600 at induction, inducer concentration, temperature, duration)

    • Scale-up considerations including adequate aeration and nutrient availability

  • Construct Optimization:

    • Bioinformatic analysis to identify potential flexible regions that might hinder crystallization

    • Generation of expression constructs with varied N- and C-terminal boundaries

    • Surface entropy reduction mutations to promote crystal contacts

    • Introduction of stabilizing mutations based on computational prediction or directed evolution

  • Purification Enhancement:

    • Multi-step chromatography optimization including:

      • IMAC with optimized imidazole gradient

      • Ion exchange chromatography at carefully selected pH

      • Hydrophobic interaction chromatography if appropriate

      • Final polishing with high-resolution size exclusion chromatography

    • On-column refolding protocols for challenging constructs

    • Tag removal optimization for crystallization samples

  • Quality Assessment:

    • Dynamic light scattering to assess monodispersity

    • Thermal shift assays to identify stabilizing buffer conditions

    • Limited proteolysis to detect flexible regions

    • Mass spectrometry for intact mass verification and PTM analysis

    • Circular dichroism to confirm secondary structure content

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) for absolute molecular weight and oligomeric state determination

How should researchers interpret sequence homology data for R07B7.12 given its uncharacterized status?

Sequence analysis represents a crucial first step in understanding uncharacterized proteins like R07B7.12. Researchers should approach homology interpretation with these methodological considerations:

  • Comprehensive Homology Detection:

    • Employ sensitive sequence comparison tools beyond BLAST, including PSI-BLAST, HHpred, and HMMER

    • Use multiple sequence alignment methods (MUSCLE, MAFFT, T-Coffee) to identify conserved residues

    • Leverage profile-based searches that can detect remote homologies invisible to pairwise alignments

    • Consider three-dimensional structure prediction tools (AlphaFold, RoseTTAFold) to identify structural homologs with potentially similar functions despite low sequence identity

  • Conservation Pattern Analysis:

    • Distinguish between broadly conserved residues (potential structural importance) and specifically conserved residues (potential functional importance)

    • Analyze conservation patterns across evolutionary distances, from closely related nematodes to distant eukaryotes

    • Map conservation onto predicted structural models to identify functional surfaces

    • Look for co-evolution patterns that might indicate interaction interfaces or functional coupling

  • Domain and Motif Identification:

    • Utilize domain databases (Pfam, InterPro, SMART) for known domain recognition

    • Search for short functional motifs using tools like ELM and MEME

    • Analyze hydrophobicity profiles and transmembrane prediction algorithms to identify potential membrane-association regions

    • Look for post-translational modification motifs using dedicated prediction tools

  • Phylogenetic Analysis:

    • Construct robust phylogenetic trees to understand the evolutionary history of R07B7.12

    • Identify orthologs versus paralogs to distinguish functional equivalence from divergence

    • Look for gene duplication or loss events that might indicate functional specialization

    • Correlate presence/absence patterns with specific traits across species

What statistical approaches are most appropriate for analyzing R07B7.12 expression data across different experimental conditions?

Rigorous statistical analysis is essential for interpreting expression data related to R07B7.12 across experimental conditions:

  • Preprocessing and Normalization:

    • Adjust for technical variations using appropriate normalization methods (quantile normalization for microarray data, TPM/RPKM for RNA-seq)

    • Apply batch effect correction if experiments were performed across multiple batches

    • Assess data quality metrics and remove outliers based on objective criteria

    • Implement appropriate transformation (log transformation) to achieve approximate normality

  • Differential Expression Analysis:

    • For parametric testing, apply ANOVA or t-tests with multiple testing correction (Benjamini-Hochberg procedure)

    • For RNA-seq data, use specialized tools like DESeq2 or edgeR that model count data appropriately

    • Include relevant covariates in the statistical model to account for confounding factors

    • Calculate effect sizes (fold changes) along with statistical significance to assess biological relevance

  • Correlation Analysis:

    • Identify genes with expression patterns similar to R07B7.12 using Pearson or Spearman correlation

    • Apply clustering methods (hierarchical clustering, k-means) to identify co-expressed gene modules

    • Use weighted gene co-expression network analysis (WGCNA) for comprehensive co-expression network construction

    • Perform gene set enrichment analysis to identify pathways associated with R07B7.12 expression changes

  • Temporal and Spatial Analysis:

    • For time-series data, apply specialized tools like maSigPro or next-maSigPro

    • For tissue-specific expression, use mixed-effect models that account for within-tissue correlation

    • Consider developmental stage-specific analysis using appropriate regression models

    • Implement visualization techniques that capture spatiotemporal patterns effectively

How can researchers distinguish between direct and indirect effects in functional studies of R07B7.12?

Distinguishing direct from indirect effects is crucial for accurate functional characterization of proteins like R07B7.12:

  • Experimental Design Strategies:

    • Implement rapid induction/inhibition systems (auxin-inducible degron, temperature-sensitive alleles) to observe immediate versus delayed effects

    • Perform time-course experiments with fine temporal resolution to separate primary from secondary responses

    • Design dose-response studies to identify concentration-dependent effects indicating direct interaction

    • Use in vitro reconstitution with purified components to test direct biochemical activities

  • Molecular Interaction Validation:

    • Employ proximity labeling approaches (BioID, APEX) to identify proteins physically close to R07B7.12 in vivo

    • Conduct in vitro binding assays with purified components to confirm direct interactions

    • Perform mutational analysis of interaction interfaces to specifically disrupt direct interactions

    • Use FRET or BiFC techniques to visualize direct interactions in cellular contexts

  • Genetic Approaches:

    • Design epistasis experiments to order gene function in pathways

    • Implement genetic suppressor screens to identify direct functional partners

    • Create separation-of-function mutations that disrupt specific activities

    • Utilize synthetic genetic array analysis to map genetic interaction networks

  • Systems Biology Integration:

    • Integrate transcriptomic, proteomic, and metabolomic data to distinguish immediate from downstream effects

    • Apply causal network inference algorithms to predict direct regulatory relationships

    • Correlate physical interaction data with functional outcomes to prioritize direct effectors

    • Model kinetics of responses to separate rapid direct effects from slower indirect ones

What evolutionary insights can be gained from studying R07B7.12 orthologs across different species?

Evolutionary analysis of R07B7.12 orthologs provides valuable context for functional interpretation:

  • Ortholog Identification Strategy:

    • Implement reciprocal best hit approaches combined with synteny analysis to identify true orthologs

    • Distinguish orthologs (same function, different species) from paralogs (related genes within species)

    • Construct gene trees to visualize the evolutionary history of the UPF0392 family

    • Map gene duplication and loss events across phylogenetic lineages

  • Sequence Conservation Patterns:

    • Calculate site-specific evolutionary rates to identify functionally constrained regions

    • Apply methods to detect signatures of positive selection which might indicate adaptive evolution

    • Identify lineage-specific accelerated evolution that might correlate with species-specific traits

    • Map conservation patterns onto structural models to identify functional surfaces versus variable regions

  • Structure-Function Relationships:

    • Compare predicted or experimental structures across diverse orthologs

    • Identify structurally conserved elements that persist despite sequence divergence

    • Analyze co-evolution patterns that might indicate interacting residues

    • Examine conservation of post-translational modification sites across orthologs

  • Expression Pattern Evolution:

    • Compare tissue-specific expression profiles across species

    • Analyze regulatory element conservation in promoter and enhancer regions

    • Investigate developmental timing of expression across orthologs

    • Correlate expression pattern changes with phenotypic innovations

How does the structure and function of R07B7.12 compare to other members of the UPF0392 protein family?

Comparative analysis within the UPF0392 family provides context for understanding R07B7.12 function:

  • Family-wide Sequence Analysis:

    • Construct comprehensive multiple sequence alignments of all UPF0392 family members

    • Identify core conserved regions that define family membership

    • Detect subfamily-specific sequence signatures that might indicate functional specialization

    • Analyze conservation of predicted active sites or binding motifs across the family

  • Structural Comparison:

    • Generate homology models based on any experimentally determined structures within the family

    • Compare predicted structural features across family members

    • Identify conserved structural elements versus variable regions

    • Analyze electrostatic surface properties that might indicate functional differences

  • Functional Diversity Assessment:

    • Compile known functional data for any characterized UPF0392 family members

    • Look for correlation between sequence divergence and functional differences

    • Analyze gene knockout phenotypes across multiple species for comparison

    • Investigate tissue-specific expression patterns across the family

  • Evolutionary Classification:

    • Develop a robust phylogenetic classification of UPF0392 subfamilies

    • Map functional annotations onto the phylogenetic tree to trace functional evolution

    • Identify key ancestral sequences at major branch points

    • Reconstruct the evolutionary trajectory of functional diversification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.