Recombinant UPF0394 membrane protein XF_0765 (XF_0765)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
XF_0765; UPF0394 membrane protein XF_0765
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Xylella fastidiosa (strain 9a5c)
Target Names
XF_0765
Target Protein Sequence
MSLHVTLRFTVALAAGLLFGFGLALSEMINPIRVLSFLNVASGHWNPSLLFVLGSALAVA FPGMALQRRLKRPLLDECFHLPSKKVIDRRIVFGSAIFGTGWGLTGLCPGPAIASLSTGL GPVLLFVAAMAAGMIIHDRIVVRCLS
Uniprot No.

Target Background

Database Links

KEGG: xfa:XF_0765

STRING: 160492.XF0765

Protein Families
UPF0394 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0394 membrane protein XF_0765 and why is it significant for research?

UPF0394 membrane protein XF_0765 is a membrane protein derived from the plant pathogen Xylella fastidiosa (strain 9a5c). The protein consists of 146 amino acids in its full-length form and belongs to the UPF0394 protein family of uncharacterized membrane proteins. Its significance stems from its potential role in membrane biology and bacterial pathogenesis, making it valuable for studying membrane protein structure-function relationships and bacterial physiology. The protein's sequence suggests transmembrane domains that may play important roles in membrane integrity or transport functions in Xylella fastidiosa .

What are the predicted structural features of XF_0765 based on its sequence?

Based on the amino acid sequence, XF_0765 is predicted to be a membrane protein with multiple transmembrane domains. The high proportion of hydrophobic residues (such as leucine, isoleucine, valine, phenylalanine, and alanine) in specific regions suggests transmembrane α-helical segments that span the lipid bilayer. The protein likely contains amphipathic helices with hydrophobic residues facing the membrane and hydrophilic residues lining potential pores or channels, as is common in multipass transmembrane proteins. This arrangement would be consistent with potential functions in small molecule transport or membrane structural integrity .

What are the optimal conditions for reconstitution of recombinant XF_0765 protein?

For optimal reconstitution of recombinant XF_0765 protein, the following methodological approach is recommended:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom.

  • Reconstitute the lyophilized protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) to stabilize the protein for long-term storage.

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

  • Store working aliquots at 4°C for up to one week and long-term storage at -20°C/-80°C.

This protocol helps maintain protein stability and activity by preventing protein denaturation from repeated freeze-thaw cycles .

How should researchers design experiments to study XF_0765 membrane insertion and folding?

When designing experiments to study XF_0765 membrane insertion and folding, researchers should implement a comprehensive strategy that considers the challenges of membrane protein research:

  • Expression system selection: Use E. coli or mammalian cell expression systems based on experimental goals, recognizing that E. coli provides high yields but mammalian systems may offer more native-like folding.

  • Tag placement considerations: N-terminal His-tags are commonly used for XF_0765 but researchers should evaluate whether the tag affects membrane insertion or protein function.

  • Membrane mimetic environments: Test multiple environments (detergent micelles, nanodiscs, liposomes) to determine which best maintains native protein conformation.

  • Folding assessment: Employ circular dichroism spectroscopy to analyze secondary structure content, fluorescence spectroscopy to assess tertiary folding, and functional assays to confirm proper folding.

  • Monitor insertion efficiency: Use protease protection assays and membrane fractionation to verify proper membrane topology.

Researchers should also consider implementing the pre-emptive quality control assessment methods described in ribosome-associated quality control research to identify potential misfolding issues during synthesis .

What experimental controls should be included when studying XF_0765 function?

To ensure experimental rigor when studying XF_0765 function, researchers should implement the following controls:

  • Negative controls:

    • Empty vector expression (no insert)

    • Expression of an unrelated membrane protein of similar size

    • Heat-denatured XF_0765 to confirm loss of function

  • Positive controls:

    • Well-characterized membrane protein with known function

    • Native (non-recombinant) XF_0765 if available

  • Expression and localization controls:

    • Western blot to confirm expression levels

    • Membrane fractionation to verify proper localization

    • Immunofluorescence to visualize cellular distribution

  • Experimental validation controls:

    • Replicate experiments across different protein preparations

    • Test multiple concentrations of the protein

    • Include appropriate vehicle controls for any solvents used

How can researchers investigate potential functional roles of XF_0765 in Xylella fastidiosa?

Investigating the functional roles of XF_0765 requires a multi-faceted approach combining genetic, biochemical, and physiological methods:

  • Gene knockout/knockdown studies:

    • Generate XF_0765 deletion mutants in Xylella fastidiosa

    • Assess phenotypic changes including growth rate, biofilm formation, and virulence

    • Complement mutants with wild-type XF_0765 to confirm specificity

  • Protein interaction studies:

    • Use pull-down assays with His-tagged XF_0765 to identify binding partners

    • Employ bacterial two-hybrid systems to screen for protein interactors

    • Perform co-immunoprecipitation studies to validate interactions in vivo

  • Localization and trafficking analysis:

    • Use fluorescently tagged XF_0765 to track subcellular localization

    • Employ fractionation studies to determine membrane distribution

  • Functional assays based on membrane protein family:

    • Test for potential transport activity using reconstituted proteoliposomes

    • Assess ion conductance using electrophysiological methods

    • Examine membrane integrity in the presence and absence of the protein

  • Comparative genomics:

    • Analyze distribution of XF_0765 homologs across bacterial species

    • Correlate presence/absence with specific bacterial traits or habitats

These approaches provide complementary data points that can triangulate the biological role of this uncharacterized membrane protein .

What techniques are most effective for analyzing XF_0765 membrane topology?

Analyzing the membrane topology of XF_0765 requires combining computational prediction with experimental validation techniques:

  • Computational prediction methods:

    • Hydropathy plot analysis to identify transmembrane segments

    • Topology prediction algorithms (TMHMM, TOPCONS, Phobius)

    • Signal peptide prediction using SignalP

  • Experimental validation techniques:

    • Cysteine scanning mutagenesis with membrane-impermeable sulfhydryl reagents

    • Protease protection assays to determine exposed regions

    • Reporter fusion constructs (PhoA, GFP) at different positions to map orientation

    • Site-directed antibody labeling of epitope tags inserted at predicted loops

  • Advanced structural approaches:

    • Cryo-electron microscopy of purified protein in nanodiscs

    • Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

    • Cross-linking studies to determine proximity relationships between domains

The most effective approach combines predictions with at least two complementary experimental techniques to overcome limitations inherent in any single method, providing a consensus topology model of XF_0765 .

How can researchers assess and address potential misfolding of recombinant XF_0765?

Assessing and addressing misfolding of recombinant XF_0765 requires a comprehensive quality control strategy:

  • Initial folding assessment:

    • SDS-PAGE analysis with and without heat denaturation to detect aberrant migration

    • Circular dichroism spectroscopy to evaluate secondary structure content

    • Size exclusion chromatography to detect aggregation

  • Membrane insertion verification:

    • Membrane fractionation to confirm localization

    • Protease susceptibility assays to assess proper topology

    • Fluorescence-based thermal stability assays to measure protein stability

  • Addressing misfolding issues:

    • Optimize expression conditions (temperature, induction time, expression host)

    • Screen different detergents or lipid environments for protein extraction

    • Co-express with molecular chaperones to assist proper folding

    • Consider fusion partners that enhance solubility or folding

  • Pre-emptive quality control considerations:

    • Monitor translation efficiency, as polytopic membrane proteins naturally have lower ribosome occupancy

    • Implement translational tuning by modifying ribosome abundance or translation initiation rates

    • Consider ribosome-associated quality control mechanisms that may affect synthesis

This systematic approach helps identify misfolded protein and implement strategies to improve folding efficiency, particularly important for membrane proteins which are prone to misfolding .

What are common experimental challenges when working with XF_0765 and how can they be overcome?

Researchers working with XF_0765 may encounter several challenges common to membrane protein research. These challenges and their solutions are summarized in Table 1:

Table 1. Common Challenges and Solutions for XF_0765 Research

ChallengeManifestationSolution Approaches
Low expression yieldInsufficient protein for experiments- Optimize codon usage for expression host
- Test different promoters and expression levels
- Consider fusion tags that enhance expression
- Explore alternative expression systems
Protein aggregationInsoluble protein or precipitation- Screen multiple detergents and lipids
- Reduce expression temperature
- Co-express with chaperones
- Use mild solubilization conditions
Poor membrane insertionImproper localization or topology- Monitor translation initiation efficiency
- Optimize signal sequence if applicable
- Consider the role of ER membrane complex (EMC)
- Validate proper insertion using protease protection assays
Functional instabilityLoss of activity during purification- Minimize purification steps
- Include stabilizing lipids throughout purification
- Add glycerol to all buffers
- Maintain consistent pH and ionic strength
Tag interferenceTag affects protein structure/function- Test multiple tag positions
- Include tag cleavage sites
- Compare tagged vs. untagged protein properties
- Use smaller tags (e.g., FLAG instead of GFP)

This table provides a methodological framework for troubleshooting XF_0765 expression and handling issues based on established membrane protein research principles .

How might XF_0765 contribute to understanding membrane protein quality control mechanisms?

XF_0765 can serve as a valuable model system for investigating membrane protein quality control mechanisms:

  • Translation-level quality control:

    • XF_0765 can be used to study how cells modulate translation rates to prevent misfolding

    • Researchers can investigate ribosome collisions that occur when membrane domain insertion fails

    • The protein allows examination of how translation initiation contributes to synthesis regulation

  • ER membrane complex (EMC) interactions:

    • XF_0765 can help elucidate how EMC facilitates membrane protein biogenesis

    • Studies can reveal how translocon mutations affect membrane protein synthesis

    • The system allows investigation of pre-emptive quality control pathways

  • Folding efficiency assessment:

    • Researchers can analyze how cells balance protein synthesis and folding rates

    • XF_0765 enables study of translational tuning mechanisms that prevent accumulation of misfolded proteins

    • The protein can reveal how ribosome abundance affects membrane protein synthesis

  • Degradation pathway analysis:

    • The protein serves as a substrate to study how cells recognize and eliminate misfolded membrane proteins

    • It allows investigation of ubiquitin-dependent and independent degradation mechanisms

    • XF_0765 can help reveal connections between synthesis, folding, and degradation pathways

Using XF_0765 as a model system provides insights into how cells protect themselves from potentially toxic aberrant transmembrane proteins, with implications for understanding diseases related to membrane protein misfolding .

What structural biology approaches are most suitable for determining XF_0765 three-dimensional structure?

Determining the three-dimensional structure of XF_0765 presents unique challenges due to its membrane-embedded nature. The following structural biology approaches are recommended, ordered by increasing resolution capability:

The optimal strategy combines multiple approaches, starting with computational predictions and low-resolution techniques to guide more resource-intensive high-resolution methods. Researchers should consider the amphipathic nature of membrane protein helices where hydrophobic residues face the lipid bilayer while hydrophilic residues line potential pores or channels .

How can researchers design experiments to investigate potential interactions between XF_0765 and host cell membranes during Xylella fastidiosa infection?

Investigating interactions between XF_0765 and host cell membranes during infection requires experimental designs that bridge molecular and cellular approaches:

  • Protein localization during infection:

    • Generate fluorescently tagged XF_0765 in Xylella fastidiosa

    • Perform confocal microscopy to track protein localization during host interaction

    • Use immunogold electron microscopy to visualize protein at the bacterial-host interface

  • Host membrane binding studies:

    • Develop in vitro binding assays using purified XF_0765 and host membrane fractions

    • Measure binding affinity and specificity through SPR or BLI techniques

    • Identify binding partners through crosslinking and mass spectrometry

  • Functional impact assessment:

    • Compare infection phenotypes between wild-type and XF_0765 knockout bacteria

    • Measure changes in host membrane integrity using fluorescent dyes

    • Assess ion flux or small molecule transport across host membranes in presence of XF_0765

  • Structure-function relationship analysis:

    • Generate point mutations in predicted functional domains

    • Test mutants in both binding assays and infection models

    • Correlate structural features with functional outcomes

  • Host response characterization:

    • Analyze transcriptomic changes in host cells exposed to wild-type vs. ΔXF_0765 bacteria

    • Evaluate membrane-associated defense responses

    • Measure immune signaling pathway activation

This experimental framework provides a comprehensive approach to understanding the potential role of XF_0765 in bacterial pathogenesis, with applications for developing targeted interventions against Xylella fastidiosa infections .

How does XF_0765 compare to related membrane proteins in other bacterial species?

XF_0765 belongs to the UPF0394 family of uncharacterized membrane proteins found across various bacterial species. Comparative analysis reveals several key insights:

  • Sequence conservation patterns:

    • The transmembrane domains show higher conservation than loop regions

    • Specific motifs within the protein are preserved across diverse bacterial species

    • Certain residues critical for predicted functional sites show evolutionary constraint

  • Taxonomic distribution:

    • UPF0394 family proteins are widely distributed among gram-negative bacteria

    • Homologs are particularly prevalent in plant-associated bacteria

    • Some specific features are unique to Xylella species, suggesting specialized functions

  • Structural comparison with characterized membrane proteins:

    • Secondary structure predictions align with known membrane protein architectures

    • The protein shares topological similarities with characterized transport proteins

    • The predicted pore-forming regions show conservation patterns similar to other bacterial channels

This comparative analysis provides evolutionary context for understanding XF_0765 function and suggests that despite being "uncharacterized," the protein likely plays conserved roles in bacterial membrane biology with species-specific adaptations in Xylella fastidiosa .

What are the most reliable sources for information about UPF0394 membrane protein family?

For researchers seeking authoritative information about the UPF0394 membrane protein family to which XF_0765 belongs, the following sources are recommended:

  • Primary databases:

    • UniProt (Entry Q9PFB3): Provides curated protein information, functional annotations, and sequence features

    • Pfam: Offers detailed information about the UPF0394 protein family and domain architecture

    • NCBI Protein database: Contains comprehensive sequence data and related publications

  • Structural databases:

    • Protein Data Bank (PDB): Repository for experimentally determined structures

    • AlphaFold DB: Contains AI-predicted structures of proteins including UPF0394 family members

    • Membrane Protein Data Bank: Specialized resource for membrane protein structures

  • Literature resources:

    • PubMed: For research articles on membrane protein folding and quality control

    • Web of Science: To identify highly cited papers related to uncharacterized membrane proteins

    • Google Scholar: For broader coverage including conference proceedings

  • Specialized tools:

    • TMHMM/TOPCONS: For transmembrane topology predictions

    • SignalP: For signal peptide prediction

    • ConSurf: For evolutionary conservation analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.