Recombinant UPF0397 protein CPE1584 (CPE1584)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant CPE1584 is synthesized through recombinant DNA technology, which combines genetic material from multiple sources to produce proteins in heterologous expression systems . This protein is encoded by the CPE1584 gene in C. perfringens, a pathogenic bacterium associated with gastrointestinal infections and gas gangrene .

Primary Structure

  • Amino Acid Sequence:
    MKKNKLSIKTIVAIGIGSAVFMILGRFGSLPTGIPNTNIETAYAFLALMALLYGPLAGFLIGFIGHALKDIVFFGSPWISWVFASGIVGLIIGFGARFIKINQGVFKLKQIFMFNLIQIIANGVAWFLVAPTLDILIYSEPANKVYLQGVIGGISNMVTVGVLGTILIANYAKTRIQKGSLRKEY

  • Length: 185 amino acids

  • Molecular Mass: ~20 kDa

Predicted Features

  • Contains hydrophobic regions indicative of transmembrane or membrane-associated domains.

  • Includes conserved motifs typical of the UPF0397 family, though their functional implications remain uncharacterized .

Applications in Research

Recombinant CPE1584 is primarily used as a reagent in:

  • Immunoassays: Commercial ELISA kits utilize this protein to detect antibodies or study antigen-antibody interactions .

  • Structural Biology: Its compact size and solubility make it suitable for crystallization trials or NMR studies .

  • Antigen Production: Serves as an immunogen for generating antibodies in model organisms .

Knowledge Gaps and Future Directions

The UPF0397 family remains understudied, highlighting the need for:

  • Functional studies to elucidate CPE1584’s role in C. perfringens physiology.

  • Structural analyses to map its active sites or interaction partners.

  • In vivo models to assess its contribution to bacterial pathogenicity.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Standard shipping utilizes blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. In general, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will prioritize fulfilling your specific tag type request if you have specified it. Please inform us of any tag type preferences during your order.
Synonyms
CPE1584; UPF0397 protein CPE1584
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Clostridium perfringens (strain 13 / Type A)
Target Names
CPE1584
Target Protein Sequence
MKKNKLSIKTIVAIGIGSAVFMILGRFGSLPTGIPNTNIETAYAFLALMALLYGPLAGFL IGFIGHALKDIVFFGSPWISWVFASGIVGLIIGFGARFIKINQGVFKLKQIFMFNLIQII ANGVAWFLVAPTLDILIYSEPANKVYLQGVIGGISNMVTVGVLGTILIANYAKTRIQKGS LRKEY
Uniprot No.

Target Background

Database Links

KEGG: cpe:CPE1584

Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining the stability of recombinant UPF0397 protein CPE1584?

Proper storage of recombinant UPF0397 protein CPE1584 is critical for maintaining its structural integrity and functional activity. The recommended storage conditions are:

Storage PurposeTemperatureDurationNotes
Regular storage-20°CMonthsIn Tris-based buffer with 50% glycerol
Long-term storage-80°CYearsAliquoted to avoid freeze-thaw cycles
Working solutions4°CUp to one weekFor ongoing experiments

The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein's stability . It is strongly recommended to avoid repeated freeze-thaw cycles as these can lead to protein denaturation, aggregation, and loss of activity. Researchers should create multiple small aliquots during initial handling to minimize the need for repeated thawing of the entire stock . For extended research projects, storing the protein at -80°C rather than -20°C will better preserve activity over periods exceeding several months.

What expression systems are commonly used for producing recombinant UPF0397 protein CPE1584?

While the search results don't specify which expression system was used for the commercially available UPF0397 protein CPE1584, several expression systems are suitable for membrane-associated proteins like this one. The choice depends on research requirements for protein folding, post-translational modifications, and yield:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay have challenges with membrane protein folding
Pichia pastorisGood for membrane proteins, proper protein foldingRequires optimization of the unfolded protein response (UPR) pathway
Mammalian cellsBest for complex folding, native-like modificationsLower yield, higher cost, longer production time

For membrane proteins like UPF0397 protein CPE1584, the Pichia pastoris system often provides a good balance between yield and proper folding. The UPR pathway in P. pastoris can be engineered to enhance proper folding of recombinant proteins by co-expressing chaperones and foldases that assist in protein processing . This is particularly relevant for membrane-associated proteins that may be challenging to express in prokaryotic systems.

How does the unfolded protein response (UPR) pathway affect the expression and quality of recombinant UPF0397 protein CPE1584?

The unfolded protein response (UPR) plays a critical role in the successful expression of membrane proteins like UPF0397 protein CPE1584. When expressing such proteins, particularly in eukaryotic systems like Pichia pastoris, understanding and optimizing the UPR pathway can significantly improve yield and quality.

The UPR is triggered when unfolded or misfolded proteins accumulate in the endoplasmic reticulum (ER), causing ER stress. This activates a signaling cascade involving several key components:

UPR ComponentFunctionRelevance to CPE1584 Expression
Ire1pKinase/RNase that senses ER stressMonitors folding status during expression
Hac1pTranscription factorUpregulates chaperones and foldases
Kar2p/BiPER chaperoneAssists with proper folding

What experimental approaches can be used to determine the molecular function of UPF0397 protein CPE1584?

Determining the function of proteins like UPF0397 protein CPE1584, which belongs to a protein family with uncharacterized function (UPF), requires a multi-faceted experimental approach:

Experimental ApproachMethodologyExpected Insights
Structural AnalysisX-ray crystallography, cryo-EM, or NMR spectroscopy3D structure, binding pockets, structural homology
Localization StudiesFluorescent tagging, subcellular fractionationCellular location, potential interaction partners
Interaction ProteomicsCo-immunoprecipitation, yeast two-hybrid, BioIDProtein interaction networks
Gene Knockout/KnockdownCRISPR-Cas9, RNAi in model organismsPhenotypic effects, physiological relevance
Comparative GenomicsBioinformatic analysis across speciesEvolutionary conservation, functional predictions

A comprehensive experimental design would begin with structural characterization to identify potential functional domains, followed by localization studies to determine where in the bacterium the protein functions. The membrane-associated nature of UPF0397 protein CPE1584, evident from its sequence characteristics, suggests it may play a role in membrane integrity, transport, or signaling .

What are the key considerations for designing experiments to study protein-membrane interactions of UPF0397 protein CPE1584?

Designing experiments to study the membrane interactions of UPF0397 protein CPE1584 requires careful planning of variables, controls, and measurement techniques:

  • Experimental System Selection:

    • Synthetic lipid bilayers provide controlled environments but lack biological complexity

    • Native membrane extracts offer physiological relevance but introduce variability

    • Cell-based assays provide context but may have confounding factors

  • Key Variables to Consider:

Variable TypeExamplesControl Methods
IndependentLipid composition, pH, ionic strengthSystematic variation while keeping other factors constant
DependentBinding affinity, membrane insertion depth, structural changesMultiple measurement techniques for cross-validation
ConfoundingTemperature fluctuations, sample oxidationStrict temperature control, oxygen-free conditions
  • Appropriate Measurement Techniques:

    • Fluorescence resonance energy transfer (FRET) to measure distance relationships

    • Surface plasmon resonance (SPR) for binding kinetics

    • Attenuated total reflection Fourier transform infrared spectroscopy (ATR-FTIR) for structural information

    • Atomic force microscopy (AFM) for topographical changes

  • Experimental Controls:

    • Positive control: Known membrane-binding protein with similar characteristics

    • Negative control: Soluble protein variant lacking membrane-binding domains

    • System control: Measurements in buffer-only conditions

The experimental design should follow a systematic approach, with initial hypothesis formulation, treatment design, careful subject assignment, and precise measurement protocols . For UPF0397 protein CPE1584, special attention should be paid to maintaining the native structure of the protein, as denaturation could significantly alter membrane interactions and lead to misleading results.

How can researchers optimize purification strategies for recombinant UPF0397 protein CPE1584 while maintaining functional integrity?

Purifying membrane-associated proteins like UPF0397 protein CPE1584 presents unique challenges that require specialized approaches to maintain structural and functional integrity:

Purification StageKey ConsiderationsOptimization Strategies
Cell LysisMembrane disruption without denaturing proteinGentle detergents, osmotic shock methods
SolubilizationMaintaining native conformationScreen multiple detergents (DDM, CHAPS, OG)
Affinity ChromatographyTag interference with functionCleavable tags, optimization of tag position
Detergent ExchangeCompatibility with downstream applicationsGradual exchange, detergent removal methods
Quality ControlAssessing purity and functionalitySEC-MALS, thermal shift assays, activity tests

For UPF0397 protein CPE1584, researchers should consider a two-phase approach. First, optimize expression conditions to maximize correct folding, utilizing UPR pathway engineering if using eukaryotic expression systems like P. pastoris . Second, develop a purification workflow that maintains the protein in a near-native membrane environment.

A critical aspect of purification is detergent selection. Initial screening should compare mild (DDM, LMNG), moderate (OG, CHAPS), and harsh (SDS) detergents for their ability to solubilize the protein while maintaining function. Once purified, validate protein quality through techniques such as thermal shift assays to confirm stability and circular dichroism to verify secondary structure integrity.

For applications requiring detergent-free protein, consider reconstitution into nanodiscs or liposomes, which provide a lipid bilayer environment that better mimics the native membrane context. This approach is particularly valuable for functional characterization studies of membrane proteins like UPF0397 protein CPE1584.

What analytical techniques are most effective for characterizing the structural features of UPF0397 protein CPE1584?

Characterizing the structural features of membrane-associated proteins like UPF0397 protein CPE1584 requires specialized analytical approaches that account for their hydrophobic nature and membrane interaction:

Analytical TechniqueInformation ProvidedConsiderations for UPF0397 protein CPE1584
Circular Dichroism (CD)Secondary structure compositionUseful for initial characterization; requires detergent compatibility
Nuclear Magnetic Resonance (NMR)Atomic-level structure in solutionSuitable for smaller domains; may require isotope labeling
X-ray CrystallographyHigh-resolution 3D structureChallenging for membrane proteins; requires stable crystal formation
Cryo-Electron Microscopy3D structure without crystallizationGrowing method for membrane proteins; works well with larger complexes
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)Dynamic structural information, solvent accessibilityUseful for mapping membrane-interacting regions
Small-Angle X-ray Scattering (SAXS)Low-resolution envelope, flexibilityComplements other techniques; works in solution

For UPF0397 protein CPE1584, a hierarchical approach is recommended, beginning with CD spectroscopy to determine secondary structure elements. The protein's 185-amino acid length and 20 kDa mass make it amenable to solution NMR if properly solubilized, potentially providing detailed structural information.

To specifically analyze membrane-interacting regions, HDX-MS can identify which segments of the protein show protection from solvent exchange when associated with lipids. Combined with computational predictions based on the amino acid sequence, these methods can generate a comprehensive structural model of how UPF0397 protein CPE1584 interacts with membranes in its native environment.

When planning structural studies, researchers should consider the impact of purification tags on protein structure. While tags facilitate purification, they may influence structural analyses. Using cleavable tags or validating that the tag doesn't impact the region of interest is essential for obtaining physiologically relevant structural data.

How should researchers design control experiments when studying the functional properties of UPF0397 protein CPE1584?

Control TypePurposeExample for UPF0397 protein CPE1584 Studies
Negative ControlsEstablish baseline, detect false positivesBuffer-only conditions, unrelated protein of similar size
Positive ControlsValidate assay functionalityWell-characterized membrane protein with known properties
Procedural ControlsIdentify method-induced artifactsDifferent purification tags, alternative detergents
Biological ControlsAccount for biological variationMultiple protein batches, testing in different membrane compositions
Dose-Response ControlsEstablish relationship validityTitration of protein concentration in functional assays

When designing experimental treatments, follow a systematic approach that manipulates one independent variable at a time while controlling others . For example, when studying membrane binding, systematically vary lipid composition while keeping protein concentration, buffer conditions, and temperature constant. This methodical approach allows for clear attribution of effects to specific variables.

Data collection should include technical replicates (repeated measurements of the same sample) to assess measurement precision and biological replicates (independent protein preparations) to account for batch-to-batch variation. Statistical analysis should be planned in advance, with appropriate tests selected based on data distribution and experimental design.

What techniques can be employed to study the potential interaction partners of UPF0397 protein CPE1584 in its native context?

Understanding the interaction network of UPF0397 protein CPE1584 requires approaches that can capture interactions while respecting the protein's membrane-associated nature:

TechniquePrincipleAdvantages for CPE1584 StudiesLimitations
Proximity Labeling (BioID, APEX)Biotinylation of nearby proteinsWorks in native membrane environmentMay capture transient interactions
Crosslinking Mass Spectrometry (XL-MS)Chemical linking of interacting proteinsCaptures direct interactionsMay alter protein conformation
Co-immunoprecipitation with Membrane FractionsAntibody-based pulldownRelatively straightforwardRequires specific antibodies
Genetic Interaction ScreensIdentifying synthetic lethality or rescueFunctional relevanceRequires genetic manipulation of host
Split Reporter Systems (DHFR, luciferase)Complementation upon interactionDetects interactions in living cellsMay have high false negative rate

For UPF0397 protein CPE1584, proximity labeling approaches like BioID offer particular advantages. The technique involves fusing CPE1584 to a biotin ligase that biotinylates proteins in close proximity. This allows for identification of the neighborhood proteins without disrupting membrane integrity. The approach would involve:

  • Creating a fusion construct of CPE1584 with BioID or APEX2

  • Expressing the construct in C. perfringens or a suitable model system

  • Activating labeling with biotin or H₂O₂ (for APEX2)

  • Lysing cells and capturing biotinylated proteins

  • Identifying interaction candidates via mass spectrometry

Control experiments should include expressing the biotin ligase alone (without CPE1584) to identify non-specific biotinylation. Validation of key interactions should be performed using orthogonal methods such as co-immunoprecipitation or fluorescence microscopy co-localization studies. This multi-technique approach provides higher confidence in the identified interaction partners and helps construct a functional context for UPF0397 protein CPE1584.

How can researchers effectively compare experimental results from different batches of recombinant UPF0397 protein CPE1584?

Batch-to-batch variability in recombinant protein production can significantly impact experimental outcomes. For UPF0397 protein CPE1584, implementing a standardized quality control and normalization approach is essential:

Quality Control ParameterAssessment MethodAcceptance Criteria
PuritySDS-PAGE, SEC-MALS>95% homogeneity
IdentityMass spectrometry, Western blotCorrect mass, immunoreactivity
Secondary StructureCircular dichroismConsistent spectral profile
Thermal StabilityDifferential scanning fluorimetryConsistent melting temperature (±2°C)
Functional ActivityApplication-specific assayWithin established performance range

To effectively compare results across different protein batches:

  • Establish a Reference Standard: Create a well-characterized reference batch that serves as a benchmark for future productions. Store multiple aliquots at -80°C to minimize freeze-thaw cycles .

  • Implement Normalization Protocols: Rather than relying solely on protein concentration, normalize based on functional activity. For membrane proteins like UPF0397 protein CPE1584, this could involve a membrane binding assay or another function-relevant metric.

  • Document Batch Information: Maintain comprehensive records of expression conditions, purification methods, and storage history for each batch. This enables retrospective analysis if unexpected variations occur.

  • Include Internal Controls: For each experiment, include both the reference standard and the new batch to enable direct comparison under identical conditions.

When publishing research involving UPF0397 protein CPE1584, transparently report batch information and normalization approaches. This enables better reproducibility and allows other researchers to account for potential batch effects when comparing their results to published data.

What are the potential functional roles of UPF0397 protein CPE1584 based on structural predictions and homology studies?

While UPF0397 protein CPE1584 belongs to a family of uncharacterized proteins (UPF), structural analysis and homology studies can provide insights into its potential functions:

Structural FeaturePrediction MethodFunctional Implication
Transmembrane helicesHydropathy analysis, TMHMMMembrane anchoring, potential channel/transporter
Conserved motifsMultiple sequence alignmentFunctional sites, evolutionary constraints
Structural homologsFold recognition, threadingFunctional analogies with characterized proteins
Surface electrostaticsHomology modeling, electrostatic calculationsPotential interaction surfaces

The amino acid sequence of UPF0397 protein CPE1584 suggests it contains multiple hydrophobic regions that likely form transmembrane helices . This membrane association, combined with its presence in the pathogenic bacterium C. perfringens, suggests several potential functional roles:

  • Membrane Integrity: It may contribute to membrane stability in C. perfringens, particularly under stress conditions.

  • Transport Function: The protein might participate in small molecule or ion transport across the bacterial membrane, potentially contributing to nutrient acquisition or waste export.

  • Signaling Role: It could function in signal transduction, sensing environmental changes and transmitting this information to the bacterial cell interior.

  • Virulence Factor: As C. perfringens is a pathogen, CPE1584 might contribute to host-pathogen interactions or survival within the host environment.

Future research directions should include comparative genomics across different C. perfringens strains and related bacteria to identify conservation patterns that might indicate functional importance. Additionally, systematic mutagenesis of conserved residues coupled with functional assays would help pinpoint critical regions for the protein's physiological role.

How might UPF0397 protein CPE1584 contribute to Clostridium perfringens pathogenicity or survival mechanisms?

As a protein from the pathogenic bacterium Clostridium perfringens, UPF0397 protein CPE1584 may play roles in virulence or bacterial survival within hosts:

Potential RoleExperimental Evidence NeededRelevance to C. perfringens Biology
Membrane AdaptationGrowth studies under various conditionsSurvival in changing host environments
Toxin SecretionSecretome analysis in knockout strainsContribution to virulence factor delivery
Antibiotic ResistanceMIC determinations in mutant strainsPersistence during antibiotic treatment
Host Cell AdhesionBinding assays with host cell modelsInitial colonization processes
Biofilm FormationBiofilm quantification assaysPersistence in environmental niches

C. perfringens causes diverse diseases including gas gangrene, food poisoning, and necrotizing enterocolitis, suggesting adaptability to different host environments. Membrane proteins like UPF0397 protein CPE1584 often contribute to this adaptability by:

  • Modifying membrane permeability in response to environmental conditions

  • Participating in nutrient acquisition within the host

  • Contributing to resistance against host defense mechanisms

  • Facilitating attachment to host tissues

To investigate these possibilities, researchers should consider gene knockout or knockdown studies in C. perfringens, followed by comprehensive phenotypic characterization including:

  • Growth curve analysis under various stress conditions

  • Virulence assessment in appropriate infection models

  • Competitive fitness studies comparing wild-type and mutant strains

  • Proteomic analysis to identify compensatory changes in protein expression

These approaches would help establish whether UPF0397 protein CPE1584 is primarily involved in basic cellular processes or plays specific roles in pathogenesis, informing potential applications in antimicrobial development or vaccine design.

What challenges and solutions exist for isotope labeling of UPF0397 protein CPE1584 for NMR structural studies?

Isotope labeling for NMR studies of membrane proteins like UPF0397 protein CPE1584 presents unique challenges that require specialized approaches:

ChallengeCauseSolution Strategy
Low expression yieldMembrane protein toxicity, folding issuesOptimization of growth conditions, controlled expression
Incomplete labelingMetabolic scrambling of isotopesUse of auxotrophic strains, optimized media formulations
Detergent interferenceBackground signals, protein destabilizationDetergent screening, deuterated detergents
Spectral crowdingProtein size (185 amino acids) Selective labeling strategies, advanced NMR techniques
Signal broadeningSlow tumbling of protein-detergent complexesFragment-based approaches, solid-state NMR methods

For UPF0397 protein CPE1584, a systematic approach to isotope labeling would involve:

  • Expression System Selection: While E. coli is commonly used for isotope labeling, the membrane nature of CPE1584 might benefit from expression in cell-free systems that allow direct incorporation into nanodiscs or liposomes.

  • Labeling Strategy:

    • Uniform ¹⁵N labeling for initial HSQC fingerprinting

    • ¹³C/¹⁵N double labeling for backbone assignment

    • Selective amino acid labeling focusing on regions of interest

    • Specific methyl group labeling (ILV labeling) for studying hydrophobic interactions

  • Advanced NMR Techniques: TROSY-based experiments to reduce line broadening, non-uniform sampling to improve resolution, and methyl-TROSY approaches to focus on hydrophobic regions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.