Recombinant CPE1584 is synthesized through recombinant DNA technology, which combines genetic material from multiple sources to produce proteins in heterologous expression systems . This protein is encoded by the CPE1584 gene in C. perfringens, a pathogenic bacterium associated with gastrointestinal infections and gas gangrene .
Amino Acid Sequence:
MKKNKLSIKTIVAIGIGSAVFMILGRFGSLPTGIPNTNIETAYAFLALMALLYGPLAGFLIGFIGHALKDIVFFGSPWISWVFASGIVGLIIGFGARFIKINQGVFKLKQIFMFNLIQIIANGVAWFLVAPTLDILIYSEPANKVYLQGVIGGISNMVTVGVLGTILIANYAKTRIQKGSLRKEY
Contains hydrophobic regions indicative of transmembrane or membrane-associated domains.
Includes conserved motifs typical of the UPF0397 family, though their functional implications remain uncharacterized .
Recombinant CPE1584 is primarily used as a reagent in:
Immunoassays: Commercial ELISA kits utilize this protein to detect antibodies or study antigen-antibody interactions .
Structural Biology: Its compact size and solubility make it suitable for crystallization trials or NMR studies .
Antigen Production: Serves as an immunogen for generating antibodies in model organisms .
The UPF0397 family remains understudied, highlighting the need for:
Functional studies to elucidate CPE1584’s role in C. perfringens physiology.
Structural analyses to map its active sites or interaction partners.
In vivo models to assess its contribution to bacterial pathogenicity.
KEGG: cpe:CPE1584
Proper storage of recombinant UPF0397 protein CPE1584 is critical for maintaining its structural integrity and functional activity. The recommended storage conditions are:
| Storage Purpose | Temperature | Duration | Notes |
|---|---|---|---|
| Regular storage | -20°C | Months | In Tris-based buffer with 50% glycerol |
| Long-term storage | -80°C | Years | Aliquoted to avoid freeze-thaw cycles |
| Working solutions | 4°C | Up to one week | For ongoing experiments |
The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein's stability . It is strongly recommended to avoid repeated freeze-thaw cycles as these can lead to protein denaturation, aggregation, and loss of activity. Researchers should create multiple small aliquots during initial handling to minimize the need for repeated thawing of the entire stock . For extended research projects, storing the protein at -80°C rather than -20°C will better preserve activity over periods exceeding several months.
While the search results don't specify which expression system was used for the commercially available UPF0397 protein CPE1584, several expression systems are suitable for membrane-associated proteins like this one. The choice depends on research requirements for protein folding, post-translational modifications, and yield:
| Expression System | Advantages | Considerations |
|---|---|---|
| E. coli | High yield, cost-effective, rapid expression | May have challenges with membrane protein folding |
| Pichia pastoris | Good for membrane proteins, proper protein folding | Requires optimization of the unfolded protein response (UPR) pathway |
| Mammalian cells | Best for complex folding, native-like modifications | Lower yield, higher cost, longer production time |
For membrane proteins like UPF0397 protein CPE1584, the Pichia pastoris system often provides a good balance between yield and proper folding. The UPR pathway in P. pastoris can be engineered to enhance proper folding of recombinant proteins by co-expressing chaperones and foldases that assist in protein processing . This is particularly relevant for membrane-associated proteins that may be challenging to express in prokaryotic systems.
The unfolded protein response (UPR) plays a critical role in the successful expression of membrane proteins like UPF0397 protein CPE1584. When expressing such proteins, particularly in eukaryotic systems like Pichia pastoris, understanding and optimizing the UPR pathway can significantly improve yield and quality.
The UPR is triggered when unfolded or misfolded proteins accumulate in the endoplasmic reticulum (ER), causing ER stress. This activates a signaling cascade involving several key components:
| UPR Component | Function | Relevance to CPE1584 Expression |
|---|---|---|
| Ire1p | Kinase/RNase that senses ER stress | Monitors folding status during expression |
| Hac1p | Transcription factor | Upregulates chaperones and foldases |
| Kar2p/BiP | ER chaperone | Assists with proper folding |
Determining the function of proteins like UPF0397 protein CPE1584, which belongs to a protein family with uncharacterized function (UPF), requires a multi-faceted experimental approach:
| Experimental Approach | Methodology | Expected Insights |
|---|---|---|
| Structural Analysis | X-ray crystallography, cryo-EM, or NMR spectroscopy | 3D structure, binding pockets, structural homology |
| Localization Studies | Fluorescent tagging, subcellular fractionation | Cellular location, potential interaction partners |
| Interaction Proteomics | Co-immunoprecipitation, yeast two-hybrid, BioID | Protein interaction networks |
| Gene Knockout/Knockdown | CRISPR-Cas9, RNAi in model organisms | Phenotypic effects, physiological relevance |
| Comparative Genomics | Bioinformatic analysis across species | Evolutionary conservation, functional predictions |
A comprehensive experimental design would begin with structural characterization to identify potential functional domains, followed by localization studies to determine where in the bacterium the protein functions. The membrane-associated nature of UPF0397 protein CPE1584, evident from its sequence characteristics, suggests it may play a role in membrane integrity, transport, or signaling .
Designing experiments to study the membrane interactions of UPF0397 protein CPE1584 requires careful planning of variables, controls, and measurement techniques:
Experimental System Selection:
Synthetic lipid bilayers provide controlled environments but lack biological complexity
Native membrane extracts offer physiological relevance but introduce variability
Cell-based assays provide context but may have confounding factors
Key Variables to Consider:
| Variable Type | Examples | Control Methods |
|---|---|---|
| Independent | Lipid composition, pH, ionic strength | Systematic variation while keeping other factors constant |
| Dependent | Binding affinity, membrane insertion depth, structural changes | Multiple measurement techniques for cross-validation |
| Confounding | Temperature fluctuations, sample oxidation | Strict temperature control, oxygen-free conditions |
Appropriate Measurement Techniques:
Fluorescence resonance energy transfer (FRET) to measure distance relationships
Surface plasmon resonance (SPR) for binding kinetics
Attenuated total reflection Fourier transform infrared spectroscopy (ATR-FTIR) for structural information
Atomic force microscopy (AFM) for topographical changes
Experimental Controls:
Positive control: Known membrane-binding protein with similar characteristics
Negative control: Soluble protein variant lacking membrane-binding domains
System control: Measurements in buffer-only conditions
The experimental design should follow a systematic approach, with initial hypothesis formulation, treatment design, careful subject assignment, and precise measurement protocols . For UPF0397 protein CPE1584, special attention should be paid to maintaining the native structure of the protein, as denaturation could significantly alter membrane interactions and lead to misleading results.
Purifying membrane-associated proteins like UPF0397 protein CPE1584 presents unique challenges that require specialized approaches to maintain structural and functional integrity:
| Purification Stage | Key Considerations | Optimization Strategies |
|---|---|---|
| Cell Lysis | Membrane disruption without denaturing protein | Gentle detergents, osmotic shock methods |
| Solubilization | Maintaining native conformation | Screen multiple detergents (DDM, CHAPS, OG) |
| Affinity Chromatography | Tag interference with function | Cleavable tags, optimization of tag position |
| Detergent Exchange | Compatibility with downstream applications | Gradual exchange, detergent removal methods |
| Quality Control | Assessing purity and functionality | SEC-MALS, thermal shift assays, activity tests |
For UPF0397 protein CPE1584, researchers should consider a two-phase approach. First, optimize expression conditions to maximize correct folding, utilizing UPR pathway engineering if using eukaryotic expression systems like P. pastoris . Second, develop a purification workflow that maintains the protein in a near-native membrane environment.
A critical aspect of purification is detergent selection. Initial screening should compare mild (DDM, LMNG), moderate (OG, CHAPS), and harsh (SDS) detergents for their ability to solubilize the protein while maintaining function. Once purified, validate protein quality through techniques such as thermal shift assays to confirm stability and circular dichroism to verify secondary structure integrity.
For applications requiring detergent-free protein, consider reconstitution into nanodiscs or liposomes, which provide a lipid bilayer environment that better mimics the native membrane context. This approach is particularly valuable for functional characterization studies of membrane proteins like UPF0397 protein CPE1584.
Characterizing the structural features of membrane-associated proteins like UPF0397 protein CPE1584 requires specialized analytical approaches that account for their hydrophobic nature and membrane interaction:
| Analytical Technique | Information Provided | Considerations for UPF0397 protein CPE1584 |
|---|---|---|
| Circular Dichroism (CD) | Secondary structure composition | Useful for initial characterization; requires detergent compatibility |
| Nuclear Magnetic Resonance (NMR) | Atomic-level structure in solution | Suitable for smaller domains; may require isotope labeling |
| X-ray Crystallography | High-resolution 3D structure | Challenging for membrane proteins; requires stable crystal formation |
| Cryo-Electron Microscopy | 3D structure without crystallization | Growing method for membrane proteins; works well with larger complexes |
| Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) | Dynamic structural information, solvent accessibility | Useful for mapping membrane-interacting regions |
| Small-Angle X-ray Scattering (SAXS) | Low-resolution envelope, flexibility | Complements other techniques; works in solution |
For UPF0397 protein CPE1584, a hierarchical approach is recommended, beginning with CD spectroscopy to determine secondary structure elements. The protein's 185-amino acid length and 20 kDa mass make it amenable to solution NMR if properly solubilized, potentially providing detailed structural information.
To specifically analyze membrane-interacting regions, HDX-MS can identify which segments of the protein show protection from solvent exchange when associated with lipids. Combined with computational predictions based on the amino acid sequence, these methods can generate a comprehensive structural model of how UPF0397 protein CPE1584 interacts with membranes in its native environment.
When planning structural studies, researchers should consider the impact of purification tags on protein structure. While tags facilitate purification, they may influence structural analyses. Using cleavable tags or validating that the tag doesn't impact the region of interest is essential for obtaining physiologically relevant structural data.
| Control Type | Purpose | Example for UPF0397 protein CPE1584 Studies |
|---|---|---|
| Negative Controls | Establish baseline, detect false positives | Buffer-only conditions, unrelated protein of similar size |
| Positive Controls | Validate assay functionality | Well-characterized membrane protein with known properties |
| Procedural Controls | Identify method-induced artifacts | Different purification tags, alternative detergents |
| Biological Controls | Account for biological variation | Multiple protein batches, testing in different membrane compositions |
| Dose-Response Controls | Establish relationship validity | Titration of protein concentration in functional assays |
When designing experimental treatments, follow a systematic approach that manipulates one independent variable at a time while controlling others . For example, when studying membrane binding, systematically vary lipid composition while keeping protein concentration, buffer conditions, and temperature constant. This methodical approach allows for clear attribution of effects to specific variables.
Data collection should include technical replicates (repeated measurements of the same sample) to assess measurement precision and biological replicates (independent protein preparations) to account for batch-to-batch variation. Statistical analysis should be planned in advance, with appropriate tests selected based on data distribution and experimental design.
Understanding the interaction network of UPF0397 protein CPE1584 requires approaches that can capture interactions while respecting the protein's membrane-associated nature:
| Technique | Principle | Advantages for CPE1584 Studies | Limitations |
|---|---|---|---|
| Proximity Labeling (BioID, APEX) | Biotinylation of nearby proteins | Works in native membrane environment | May capture transient interactions |
| Crosslinking Mass Spectrometry (XL-MS) | Chemical linking of interacting proteins | Captures direct interactions | May alter protein conformation |
| Co-immunoprecipitation with Membrane Fractions | Antibody-based pulldown | Relatively straightforward | Requires specific antibodies |
| Genetic Interaction Screens | Identifying synthetic lethality or rescue | Functional relevance | Requires genetic manipulation of host |
| Split Reporter Systems (DHFR, luciferase) | Complementation upon interaction | Detects interactions in living cells | May have high false negative rate |
For UPF0397 protein CPE1584, proximity labeling approaches like BioID offer particular advantages. The technique involves fusing CPE1584 to a biotin ligase that biotinylates proteins in close proximity. This allows for identification of the neighborhood proteins without disrupting membrane integrity. The approach would involve:
Creating a fusion construct of CPE1584 with BioID or APEX2
Expressing the construct in C. perfringens or a suitable model system
Activating labeling with biotin or H₂O₂ (for APEX2)
Lysing cells and capturing biotinylated proteins
Identifying interaction candidates via mass spectrometry
Control experiments should include expressing the biotin ligase alone (without CPE1584) to identify non-specific biotinylation. Validation of key interactions should be performed using orthogonal methods such as co-immunoprecipitation or fluorescence microscopy co-localization studies. This multi-technique approach provides higher confidence in the identified interaction partners and helps construct a functional context for UPF0397 protein CPE1584.
Batch-to-batch variability in recombinant protein production can significantly impact experimental outcomes. For UPF0397 protein CPE1584, implementing a standardized quality control and normalization approach is essential:
| Quality Control Parameter | Assessment Method | Acceptance Criteria |
|---|---|---|
| Purity | SDS-PAGE, SEC-MALS | >95% homogeneity |
| Identity | Mass spectrometry, Western blot | Correct mass, immunoreactivity |
| Secondary Structure | Circular dichroism | Consistent spectral profile |
| Thermal Stability | Differential scanning fluorimetry | Consistent melting temperature (±2°C) |
| Functional Activity | Application-specific assay | Within established performance range |
To effectively compare results across different protein batches:
Establish a Reference Standard: Create a well-characterized reference batch that serves as a benchmark for future productions. Store multiple aliquots at -80°C to minimize freeze-thaw cycles .
Implement Normalization Protocols: Rather than relying solely on protein concentration, normalize based on functional activity. For membrane proteins like UPF0397 protein CPE1584, this could involve a membrane binding assay or another function-relevant metric.
Document Batch Information: Maintain comprehensive records of expression conditions, purification methods, and storage history for each batch. This enables retrospective analysis if unexpected variations occur.
Include Internal Controls: For each experiment, include both the reference standard and the new batch to enable direct comparison under identical conditions.
When publishing research involving UPF0397 protein CPE1584, transparently report batch information and normalization approaches. This enables better reproducibility and allows other researchers to account for potential batch effects when comparing their results to published data.
While UPF0397 protein CPE1584 belongs to a family of uncharacterized proteins (UPF), structural analysis and homology studies can provide insights into its potential functions:
| Structural Feature | Prediction Method | Functional Implication |
|---|---|---|
| Transmembrane helices | Hydropathy analysis, TMHMM | Membrane anchoring, potential channel/transporter |
| Conserved motifs | Multiple sequence alignment | Functional sites, evolutionary constraints |
| Structural homologs | Fold recognition, threading | Functional analogies with characterized proteins |
| Surface electrostatics | Homology modeling, electrostatic calculations | Potential interaction surfaces |
The amino acid sequence of UPF0397 protein CPE1584 suggests it contains multiple hydrophobic regions that likely form transmembrane helices . This membrane association, combined with its presence in the pathogenic bacterium C. perfringens, suggests several potential functional roles:
Membrane Integrity: It may contribute to membrane stability in C. perfringens, particularly under stress conditions.
Transport Function: The protein might participate in small molecule or ion transport across the bacterial membrane, potentially contributing to nutrient acquisition or waste export.
Signaling Role: It could function in signal transduction, sensing environmental changes and transmitting this information to the bacterial cell interior.
Virulence Factor: As C. perfringens is a pathogen, CPE1584 might contribute to host-pathogen interactions or survival within the host environment.
Future research directions should include comparative genomics across different C. perfringens strains and related bacteria to identify conservation patterns that might indicate functional importance. Additionally, systematic mutagenesis of conserved residues coupled with functional assays would help pinpoint critical regions for the protein's physiological role.
As a protein from the pathogenic bacterium Clostridium perfringens, UPF0397 protein CPE1584 may play roles in virulence or bacterial survival within hosts:
| Potential Role | Experimental Evidence Needed | Relevance to C. perfringens Biology |
|---|---|---|
| Membrane Adaptation | Growth studies under various conditions | Survival in changing host environments |
| Toxin Secretion | Secretome analysis in knockout strains | Contribution to virulence factor delivery |
| Antibiotic Resistance | MIC determinations in mutant strains | Persistence during antibiotic treatment |
| Host Cell Adhesion | Binding assays with host cell models | Initial colonization processes |
| Biofilm Formation | Biofilm quantification assays | Persistence in environmental niches |
C. perfringens causes diverse diseases including gas gangrene, food poisoning, and necrotizing enterocolitis, suggesting adaptability to different host environments. Membrane proteins like UPF0397 protein CPE1584 often contribute to this adaptability by:
Modifying membrane permeability in response to environmental conditions
Participating in nutrient acquisition within the host
Contributing to resistance against host defense mechanisms
Facilitating attachment to host tissues
To investigate these possibilities, researchers should consider gene knockout or knockdown studies in C. perfringens, followed by comprehensive phenotypic characterization including:
Growth curve analysis under various stress conditions
Virulence assessment in appropriate infection models
Competitive fitness studies comparing wild-type and mutant strains
Proteomic analysis to identify compensatory changes in protein expression
These approaches would help establish whether UPF0397 protein CPE1584 is primarily involved in basic cellular processes or plays specific roles in pathogenesis, informing potential applications in antimicrobial development or vaccine design.
Isotope labeling for NMR studies of membrane proteins like UPF0397 protein CPE1584 presents unique challenges that require specialized approaches:
For UPF0397 protein CPE1584, a systematic approach to isotope labeling would involve:
Expression System Selection: While E. coli is commonly used for isotope labeling, the membrane nature of CPE1584 might benefit from expression in cell-free systems that allow direct incorporation into nanodiscs or liposomes.
Labeling Strategy:
Uniform ¹⁵N labeling for initial HSQC fingerprinting
¹³C/¹⁵N double labeling for backbone assignment
Selective amino acid labeling focusing on regions of interest
Specific methyl group labeling (ILV labeling) for studying hydrophobic interactions
Advanced NMR Techniques: TROSY-based experiments to reduce line broadening, non-uniform sampling to improve resolution, and methyl-TROSY approaches to focus on hydrophobic regions.