Recombinant UPF0397 protein PA0141 (PA0141)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0397 Protein PA0141

UPF0397 protein PA0141, also known simply as PA0141, is a full-length protein derived from Phytoplasma australiense. The protein belongs to the UPF0397 family, which consists of proteins with currently uncharacterized functions. The recombinant form of this protein has been developed for research purposes, typically expressed with tags such as His-tag to facilitate purification and experimental manipulation. The protein consists of 193 amino acids and is commercially available in various forms for research applications .

Expression Systems

The recombinant UPF0397 protein PA0141 is typically expressed in Escherichia coli (E. coli) expression systems. This bacterial expression system allows for efficient production of the protein in sufficient quantities for research and commercial purposes. The use of E. coli for protein expression represents a standard approach in molecular biology for producing recombinant proteins due to its well-characterized genetics, rapid growth, and high protein yields .

Reconstitution Protocol

For optimal use, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

  4. Aliquot for long-term storage at -20°C/-80°C

Research Applications

While the specific functions of PA0141 remain to be fully elucidated, the availability of recombinant forms of this protein facilitates various research applications:

  1. Structural studies to determine the three-dimensional configuration of the protein

  2. Functional assays to investigate potential enzymatic activities

  3. Protein-protein interaction studies to identify binding partners

  4. Development of antibodies against the protein for detection purposes

  5. Investigation of potential roles in cellular processes

Relationship to Polyphosphate Kinase Activity

Based on the limited information available in the search results, there appears to be a potential relationship between PA0141 and polyphosphate kinase activity. According to source , a related protein has been associated with "polyphosphate kinase 2, PA0141" functional domain and may be involved in phosphorus metabolic processes . This suggests a possible role for PA0141 in phosphorus metabolism, though further research would be needed to confirm this function specifically for the Phytoplasma australiense PA0141 protein.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PA0141; UPF0397 protein PA0141
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-193
Protein Length
full length protein
Species
Phytoplasma australiense
Target Names
PA0141
Target Protein Sequence
MKKNTSIKQTVTIAINTAIYVILSCFASIPIGPNVVLETSFSFLVFVAVLFGSKVGLSVG LLGHIIKDFFLFGNVYFNWIVCSGLLGFLFGLSKNLINLKYHSFTRKKILFFWLYQVFVN VLVFGLIAPISDVWIYAQPLKLVFLQGFLVVLSNILSYSLFGIFLMSKYSNNYGKKEVLA SNNCVYYKKPPLF
Uniprot No.

Target Background

Database Links

KEGG: pal:PA0141

STRING: 59748.PAa_0141

Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.