Recombinant UPF0421 protein BA_2743/GBAA_2743/BAS2557 (BA_2743, GBAA_2743, BAS2557)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0421 Protein BA_2743/GBAA_2743/BAS2557

UPF0421 protein BA_2743/GBAA_2743/BAS2557 is a protein identified in Bacillus anthracis, the gram-positive, spore-forming bacterium responsible for anthrax disease. The designation "UPF" (Uncharacterized Protein Family) indicates that this protein belongs to a family whose precise biological functions have not been fully elucidated . The identifiers BA_2743, GBAA_2743, and BAS2557 represent the gene locus designations in different B. anthracis strain annotations, referring to essentially the same protein across these strains . This protein has been assigned the UniProt identifier Q81PQ8, providing a standardized reference point in protein databases .

The protein is part of a conserved family found across multiple bacterial species, as evidenced by the existence of homologous proteins such as UPF0421 protein SA1705 in Staphylococcus aureus . This conservation across different bacterial species suggests that the protein may serve fundamental functions in bacterial physiology. While direct functional characterization remains limited, research into its recombinant forms has progressed significantly, offering insights into its structural and biochemical properties.

Predicted Secondary and Tertiary Structure

Based on sequence analysis and comparison with similar proteins, UPF0421 protein BA_2743/GBAA_2743/BAS2557 likely contains multiple transmembrane domains. The N-terminal region contains sequences characteristic of signal peptides, suggesting the protein may be exported or membrane-anchored . While definitive three-dimensional structural data is not yet available for this specific protein, researchers have made progress in determining structures of other B. anthracis proteins, establishing methodologies that could be applied to UPF0421 .

Expression Systems

The recombinant UPF0421 protein BA_2743/GBAA_2743/BAS2557 can be expressed using several different host systems, each with distinct advantages depending on research requirements. Table 1 summarizes the key expression systems and their characteristics:

Expression SystemAdvantagesApplicationsProduction Time
Escherichia coliHigh yields, cost-effective, scalableStructural studies, antibody productionShort (days)
YeastGood yields, some post-translational modificationsFunctional studiesMedium (days to weeks)
Insect cellsPost-translational modifications, proper foldingActivity assays, structural studiesMedium to long (weeks)
Mammalian cellsExtensive post-translational modifications, native-like foldingActivity studies, interaction studiesLong (weeks)

E. coli and yeast expression systems typically offer the best yields and shorter turnaround times, making them preferred choices for large-scale production and initial characterization studies . For applications requiring post-translational modifications necessary for correct protein folding or retention of specific activities, insect cells with baculovirus or mammalian expression systems may be more appropriate .

Purification Approaches

Purification of recombinantly expressed UPF0421 protein typically employs affinity chromatography, often facilitated by the addition of affinity tags such as histidine tags . The recombinant protein can be produced with high purity (>90% as determined by SDS-PAGE) through optimized purification protocols . For specific applications, the protein can be produced in different forms, including lyophilized powder that can be reconstituted as needed .

Potential Functional Roles in Bacillus anthracis

While the specific function of UPF0421 protein BA_2743/GBAA_2743/BAS2557 remains to be fully characterized, several lines of evidence suggest potential roles in B. anthracis physiology:

Membrane Association and Transport

The amino acid sequence of UPF0421 contains multiple hydrophobic regions consistent with transmembrane domains, suggesting a role in membrane structure or transport processes . Similar bacterial transmembrane proteins often function in nutrient uptake, signal transduction, or export of cellular components . The protein may contribute to B. anthracis membrane integrity or permeability, which are critical factors in bacterial survival and adaptation to different environments.

Context Within Bacillus anthracis Biology

To understand the potential significance of UPF0421 protein, it's important to consider the broader context of B. anthracis biology. The bacterium possesses a complex cell envelope architecture, including a thick peptidoglycan layer, secondary cell wall polysaccharides, S-layer proteins, and in virulent strains, a poly-γ-D-glutamic acid capsule .

Recent research has revealed that non-virulence-associated components of B. anthracis can significantly impact bacterial physiology and potentially influence pathogenesis indirectly. For example, studies have shown that certain spore components, such as the exosporium sugar anthrose, can affect vegetative B. anthracis gene regulation in both cis and trans configurations . While UPF0421 has not been directly implicated in these processes, its conservation across different bacterial species suggests it may serve important cellular functions.

Research Applications and Tools

Recombinant UPF0421 protein BA_2743/GBAA_2743/BAS2557 serves as a valuable tool for various research applications:

Immunological Studies and Diagnostics

The availability of high-purity recombinant protein enables the development of antibodies against UPF0421, which can be used for detection, localization, and functional studies . ELISA kits utilizing this recombinant protein allow for sensitive and specific detection applications, potentially contributing to diagnostic or research methodologies .

Interaction Studies

The recombinant protein can be employed in interaction studies to identify binding partners and potential functional networks. Techniques such as affinity purification coupled with mass spectrometry, yeast two-hybrid screening, or surface plasmon resonance could reveal proteins or other molecules that interact with UPF0421, providing clues about its cellular roles.

Broader Implications for Anthrax Research

Research into B. anthracis proteins, including UPF0421, contributes to the broader understanding of anthrax biology and potential therapeutic approaches:

Anthrax Disease and Pathogenesis

Anthrax primarily affects humans and ungulates, with three main forms of infection: cutaneous, gastrointestinal, and pulmonary (inhalational). While the primary virulence factors of B. anthracis are its tripartite toxin and poly-γ-D-glutamic acid capsule , auxiliary proteins like UPF0421 may contribute to bacterial fitness, survival, or adaptation during infection.

Therapeutic and Preventive Approaches

Understanding the structure and function of B. anthracis proteins provides potential targets for novel therapeutic approaches. Cell envelope components, including membrane proteins, represent accessible targets for antimicrobial development . While UPF0421 has not been directly implicated as a virulence factor, its potential role in bacterial physiology makes it a candidate for basic research that could inform future therapeutic strategies.

References Lifeome.com. UPF0421 protein BA_2- Growth Factors, Growth Hormones. CreativeBiomart.net. Recombinant Full Length Staphylococcus Aureus Upf0421 Protein Sa1705(Sa1705) Protein, His-Tagged. Biocompare.com. Recombinant Chicken UPF0444 transmembrane protein C12orf23 homolog (RCJMB04_6o13), partial. Colorectalresearch.com. ELISA Recombinant UPF0421 protein BA_2743-GBAA_2743-BAS2557(BA_2743, GBAA_2743, BAS2557). Appliedbiolabs.com. ELISA Recombinant UPF0421 protein BA_2743-GBAA_2743-BAS2557(BA_2743, GBAA_2743, BAS2557). Geog.ufl.edu. Beyond the spore, the exosporium sugar anthrose impacts vegetative Bacillus anthracis gene regulation in cis and trans. Newsroom.uvahealth.com. Researchers determine the 3-D structure of anthrax protein. Cbm15.com. ELISA Recombinant UPF0421 protein BA_2743-GBAA_2743-BAS2557(BA_2743, GBAA_2743, BAS2557). Rndsystems.com. Recombinant Human Glucosylceramidase/GBA Protein, CF. Abcam.com. Recombinant human Alpha-Synuclein protein filament. Mpg.de. Can anthrax be controlled? - Max-Planck-Gesellschaft. Pmc.ncbi.nlm.nih.gov. Assembly and Function of the Bacillus anthracis S-Layer - PMC. Pmc.ncbi.nlm.nih.gov. The Bacillus anthracis Cell Envelope: Composition, Physiological. Pubmed.ncbi.nlm.nih.gov. New Research on the Bacillus anthracis Genetic Diversity in Siberia. Pmc.ncbi.nlm.nih.gov. Bacillus anthracis: Balancing innocent research with dual-use.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
BA_2743; GBAA_2743; BAS2557; UPF0421 protein BA_2743/GBAA_2743/BAS2557
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
BA_2743
Target Protein Sequence
MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLRLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTVVNFFILPPHYVKTISGCTEELFVKTANIMEEWLTALM DGKVIIKETTYNLSKLTVLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARAPIETCDWSQNEKEILRRTIHSIISILRNHCEEIDEEHFKLIDELDKQFWT NKNDLAHCKPNQYHHHFSSKSIILFEVLSIHDMLEELKQIFEKYESENQLNCSVH
Uniprot No.

Target Background

Database Links

KEGG: ban:BA_2743

STRING: 260799.BAS2557

Protein Families
UPF0421 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for this protein, and what are their advantages?

The recombinant UPF0421 protein BA_2743/GBAA_2743/BAS2557 can be expressed in multiple host systems, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliBest yields, shorter turnaround times, cost-effectiveLimited post-translational modifications
YeastGood yields, some eukaryotic modifications, shorter turnaroundMore complex media requirements
Insect cells/baculovirusMany post-translational modifications, better folding for complex proteinsLower yields, longer production time
Mammalian cellsMost native-like post-translational modifications, best for retaining activityLowest yields, highest cost, longest production time

What are the optimal storage and handling conditions for this recombinant protein?

For optimal stability and activity retention of recombinant UPF0421 protein BA_2743, follow these research-validated storage and handling protocols:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Long-term storage: Store at -20°C, or preferably at -80°C for extended periods

  • Buffer composition: Typically supplied in Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Reconstitution: For lyophilized protein, briefly centrifuge the vial before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Aliquoting: Add 5-50% glycerol (final concentration) and prepare multiple small-volume aliquots to avoid repeated freeze-thaw cycles

  • Important note: Repeated freezing and thawing significantly reduces protein activity and should be avoided

How is protein purity assessed for recombinant UPF0421 protein BA_2743?

Purity assessment for recombinant UPF0421 protein BA_2743 typically employs multiple complementary techniques:

Primary method: SDS-PAGE with Coomassie or silver staining, aiming for purity greater than 90% as the standard quality threshold . This method separates proteins by molecular weight, allowing visualization of the target protein band at approximately 40-42 kDa and detection of potential contaminants.

Confirmatory methods:

  • Western blotting using anti-His antibodies (when His-tagged)

  • Size exclusion chromatography (SEC) to assess monodispersity and aggregation

  • Mass spectrometry to confirm exact molecular weight and sequence coverage

For research applications requiring extremely high purity, additional techniques may include:

  • Reverse-phase HPLC

  • Isoelectric focusing

  • Native PAGE to assess conformational homogeneity

What strategies can optimize expression of UPF0421 protein BA_2743 in E. coli?

For maximum yield and solubility of UPF0421 protein BA_2743 in E. coli expression systems, consider implementing these research-backed optimization strategies:

Vector and strain selection:

  • BL21(DE3) derivatives often provide highest yields for potentially toxic membrane-associated proteins

  • pET vectors with T7 promoters allow tight regulation of expression

  • Consider C41/C42 strains specifically designed for membrane proteins

Expression conditions optimization:

  • Test induction at different OD600 values (0.6-1.0)

  • Compare IPTG concentrations (0.1-1.0 mM)

  • Evaluate lower temperatures (16-25°C) during induction to improve folding

  • Extended expression periods (16-24 hours) at lower temperatures

Solubility enhancement:

  • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Fusion partners (MBP, SUMO, or TRX) can significantly increase solubility

  • Addition of compatible solutes (5-10% glycerol, 0.5-1M sorbitol) to expression media

This methodological approach addresses the common challenge that UPF0421 family proteins, having potential membrane-spanning domains, may exhibit limited solubility when expressed in standard conditions .

How can researchers characterize the membrane association properties of UPF0421 protein BA_2743?

Given the predicted membrane-associated nature of UPF0421 protein BA_2743, a systematic experimental approach to characterize its membrane interaction properties includes:

Sequential extraction analysis:

  • Fractionate E. coli cells expressing the protein into cytoplasmic, peripheral membrane, and integral membrane fractions

  • Use differential detergent treatments (mild detergents like digitonin followed by stronger ones like Triton X-100)

  • Analyze distribution by Western blotting to determine membrane association strength

Membrane topology determination:

  • Protease protection assays with inside-out and right-side-out membrane vesicles

  • Site-directed fluorescence labeling at predicted loop regions

  • Cysteine scanning mutagenesis combined with accessibility studies

Biophysical characterization:

  • Circular dichroism (CD) spectroscopy in membrane-mimetic environments

  • Reconstitution in liposomes of defined composition followed by flotation assays

  • Microscale thermophoresis to measure lipid binding affinities

The amino acid sequence analysis reveals multiple hydrophobic regions typical of membrane-spanning domains, particularly in the N-terminal half of the protein, supporting its predicted membrane association .

What approaches can help elucidate the function of uncharacterized UPF0421 protein BA_2743?

Determining the function of UPF0421 protein BA_2743 requires an integrated, multi-omics approach:

Comparative genomics strategies:

  • Analyze gene neighborhood conservation across Bacillus species

  • Identify co-evolved gene clusters through phylogenetic profiling

  • Compare sequence similarity with characterized UPF0421 proteins from related organisms like Bacillus cereus (BC_2748) and Bacillus thuringiensis (BT9727_2513)

Protein interaction studies:

  • Bacterial two-hybrid screening to identify interacting partners

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity-dependent biotin labeling (BioID) in heterologous systems

Phenotypic characterization:

  • Gene knockout/knockdown in Bacillus species followed by comprehensive phenotyping

  • Heterologous expression in model organisms to observe gain-of-function phenotypes

  • Transcriptomic analysis of mutant strains under various stress conditions

Structural biology approaches:

  • X-ray crystallography or cryo-EM to identify potential binding pockets

  • Molecular docking simulations with metabolites from relevant biochemical pathways

  • In silico structural comparisons with proteins of known function

This multi-faceted approach has proven effective for functional annotation of previously uncharacterized proteins across various bacterial species.

What techniques are appropriate for assessing protein-protein interactions involving UPF0421 protein BA_2743?

To comprehensively map the interactome of UPF0421 protein BA_2743, researchers should employ complementary techniques that address both stable and transient interactions:

In vitro interaction methods:

  • Surface plasmon resonance (SPR) for real-time binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Biolayer interferometry (BLI) to measure association/dissociation rates

Cell-based interaction assays:

  • Bacterial two-hybrid or three-hybrid systems

  • Split-GFP complementation assays

  • FRET/BRET-based interaction studies in live bacterial cells

High-throughput screening approaches:

  • Protein microarrays using purified Bacillus anthracis proteome

  • Tandem affinity purification followed by mass spectrometry (TAP-MS)

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

Validation methods:

  • Co-immunoprecipitation with specific antibodies

  • Pull-down assays using His-tagged recombinant protein

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

The GSK2801 chemoproteomic competition binding assay approach described in research paper represents a model methodology that could be adapted for UPF0421 protein interaction studies, using appropriate modifications specific to bacterial protein research.

How do UPF0421 proteins from different Bacillus species compare structurally and functionally?

Comparative analysis of UPF0421 proteins across Bacillus species reveals important structural and potential functional insights:

SpeciesProtein IdentifierLength (aa)Sequence Identity to BA_2743Key Structural Features
B. anthracisBA_2743/GBAA_2743/BAS2557355100% (reference)Multiple transmembrane regions, C-terminal cytoplasmic domain
B. cereusBC_2748351~98%Nearly identical topology, conservative substitutions
B. thuringiensisBT9727_2513358~95%Additional short insert in C-terminal region
B. subtilisYgaE349~70%More divergent sequence, conserved membrane topology

Functional implications:

  • High conservation (>95%) among pathogenic Bacillus species suggests potential role in virulence or survival

  • Conserved membrane topology implies similar subcellular localization and general function

  • Differences in C-terminal regions may reflect species-specific protein interactions

Structural conservation:
The computed structure model for BT9727_2513 from B. thuringiensis shows a predominantly alpha-helical architecture with high confidence predictions (pLDDT >90) in the core regions, which likely extends to the highly similar BA_2743 protein .

This comparative approach provides valuable context for functional hypotheses and could guide mutational studies targeting species-specific regions.

What are the recommended approaches for crystallizing membrane-associated proteins like UPF0421 BA_2743?

Crystallizing potential membrane proteins like UPF0421 BA_2743 presents significant challenges that require specialized techniques:

Detergent screening approach:

  • Solubilize the purified protein in a panel of detergents ranging from mild (DDM, LMNG) to harsh (OG, LDAO)

  • Assess protein stability and monodispersity by size exclusion chromatography in each detergent

  • Perform thermal stability assays (DSF/nanoDSF) to identify conditions that maximize protein stability

  • Proceed with crystallization trials using detergents that yield stable, monodispersic protein

Lipidic cubic phase (LCP) method:

  • Reconstitute protein in monoolein or other suitable lipid matrices

  • Set up in meso crystallization trials with various precipitants

  • Monitor crystal formation using cross-polarized light microscopy

  • Harvest crystals directly from LCP for X-ray diffraction

Alternative membrane mimetics:

  • Nanodiscs with defined lipid composition

  • Amphipols (A8-35 or PMAL-C8)

  • Styrene maleic acid lipid particles (SMALPs)

  • Peptide-based detergents (peptergents)

Protein engineering strategies:

  • Truncation of flexible domains while retaining core structure

  • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

  • Surface entropy reduction through strategic mutation of surface residues

  • Antibody fragment (Fab/nanobody) co-crystallization to provide crystal contacts

The methodological combination of these approaches has proven successful for crystallizing challenging membrane proteins and could be adapted specifically for UPF0421 BA_2743.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.