Recombinant UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format when placing your order and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on your location and the purchasing method. We recommend contacting your local distributor for specific delivery time estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference point for your own protocols.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know and we will prioritize developing your specified tag.
Synonyms
yjjB; SF4394; S4664; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yjjB
Target Protein Sequence
MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISSVKISQLGYSEP LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: sfx:S4664

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the recommended storage protocol for recombinant UPF0442 protein yjjB?

For optimal stability and biological activity, store recombinant UPF0442 protein yjjB at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer with 50% glycerol optimized for protein stability. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may lead to protein degradation and loss of activity .

When receiving lyophilized protein, if small volumes become entrapped in the seal of the product vial during shipment, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container's cap .

What is the subcellular localization of UPF0442 protein yjjB?

UPF0442 protein yjjB is classified as a multi-pass membrane protein localized to the cell membrane. This classification is based on sequence analysis and protein family characteristics. The protein contains multiple transmembrane domains that allow it to span the cell membrane several times, which is typical for membrane transport proteins or signaling receptors .

How should I design experiments to investigate the function of UPF0442 protein yjjB?

When designing experiments to investigate UPF0442 protein yjjB function, consider implementing a systematic experimental design approach:

  • Define your variables:

    • Independent variable: yjjB expression levels or mutations

    • Dependent variable: Cellular phenotypes or biochemical parameters

    • Control for extraneous variables such as cell growth conditions, expression system effects, and tag interference

  • Formulate specific hypotheses based on the protein's membrane localization and sequence family

  • Implementation approaches:

    • Gene knockout/knockdown studies to observe loss-of-function phenotypes

    • Overexpression experiments to identify gain-of-function effects

    • Site-directed mutagenesis to analyze critical residues

    • Protein-protein interaction studies to identify binding partners

  • For membrane protein studies, consider using single-subject experimental design (SSED) methods, which are particularly useful when working with challenging proteins with high individual variability in expression or function :

DesignResearch questionsAdvantagesDisadvantages
Pre-experimental (AB)Does outcome X change from baseline with yjjB overexpression?Quick and efficient to implementDoes not control for threats to internal validity
Withdrawal (ABA/ABAB)Does the phenotype covary with introduction and withdrawal of yjjB expression?Strong experimental control when effects are immediateNot all cellular effects may be reversible

What expression systems are most appropriate for producing recombinant UPF0442 protein yjjB?

Recombinant UPF0442 protein yjjB can be expressed in several host systems, with each offering distinct advantages:

  • E. coli expression systems: Most commonly used due to:

    • Native host (reducing folding issues)

    • High yield of protein production

    • Well-established protocols for membrane protein expression

    • Cost-effectiveness and rapid growth

  • Yeast expression systems:

    • Suitable for eukaryotic studies requiring post-translational modifications

    • Better for certain membrane proteins that may misfold in bacterial systems

  • Baculovirus/insect cell systems:

    • Higher eukaryotic expression system

    • Better for complex membrane proteins

    • Improved folding machinery for multi-pass membrane proteins

  • Mammalian cell systems:

    • Used when authentic mammalian post-translational modifications or folding is critical

    • Lower yield but potentially better functionality for certain applications

The tag selection should be determined based on experimental needs, with common options including His-tags for metal affinity purification, GST-tags for solubility enhancement, or smaller tags that minimize interference with protein function .

What methods are most suitable for studying potential UPF0442 protein yjjB interactions?

As a membrane protein, UPF0442 protein yjjB requires specialized approaches for studying its protein interactions. The following methods are recommended based on interaction strength and experimental goals:

MethodSuitable for yjjB interaction typeKey considerations
Co-immunoprecipitation (co-IP)Stable or strong interactionsRequires specific antibodies against yjjB or its binding partners; may need detergent optimization for membrane extraction
Pull-down assayStable or strong interactionsUtilizes tagged yjjB as "bait"; effective when no antibodies are available
CrosslinkingTransient or weak interactionsCan stabilize fleeting interactions; membrane-permeable crosslinkers (DSS) for intracellular interactions or non-permeable (BS3) for surface interactions
Label transferTransient or weak interactionsUseful for mapping interaction interfaces; considers yjjB's membrane topology
Far-western blot analysisModerately stable interactionsAllows detection of direct binding partners after SDS-PAGE separation

When working with membrane proteins like yjjB, consider:

  • Optimization of membrane solubilization conditions using appropriate detergents

  • Maintaining the native conformation during extraction

  • Using membrane-permeable crosslinkers for in situ stabilization of complexes before extraction

  • Combining multiple techniques for validation and comprehensive analysis

How can I develop a pull-down assay protocol specifically for UPF0442 protein yjjB?

For developing a pull-down assay with recombinant UPF0442 protein yjjB as bait:

  • Fusion tag selection:

    • GST-tagged yjjB for glutathione-based capture

    • His-tagged yjjB for metal chelate (nickel or cobalt) capture

    • Both tags can be used for tandem affinity purification to increase specificity

  • Expression and purification:

    • Express the tagged yjjB in E. coli (recommended based on available products)

    • Optimize membrane protein extraction using suitable detergents

    • Purify using appropriate affinity resin

  • Pull-down procedure:

    • Immobilize purified tagged yjjB on appropriate affinity resin

    • Prepare cell lysate containing potential interacting partners

    • Optimize buffer conditions (salt, pH, detergent) to maintain interactions

    • Incubate immobilized yjjB with lysate

    • Wash thoroughly to remove non-specific binders

    • Elute complexes using competitive analytes or buffer changes

  • Analysis of results:

    • Analyze eluted proteins by SDS-PAGE

    • Identify interacting partners by western blotting or mass spectrometry

    • Validate interactions using orthogonal methods like co-IP or crosslinking

For membrane proteins like yjjB, consider including specific detergents in your buffers to maintain protein solubility and native conformation throughout the procedure.

What approaches can be used to determine the function of UPF0442 protein yjjB based on its membrane localization?

As a multi-pass membrane protein, UPF0442 protein yjjB likely functions in transport, signaling, or structural roles. To elucidate its specific function:

  • Comparative genomic analysis:

    • Investigate conservation across bacterial species

    • Examine genomic context for functionally related genes

    • Look for co-expression patterns with proteins of known function

  • Topological studies:

    • Use computational prediction tools to model transmembrane segments

    • Perform accessibility studies with membrane-impermeable reagents

    • Create fusion proteins with reporter tags at various positions to map orientation

  • Transport assays:

    • Test for substrate specificity using radioactive or fluorescent tracers

    • Measure ion flux in reconstituted proteoliposomes or expression systems

    • Compare transport rates between wild-type and mutant variants

  • Protein-protein interactions focused on membrane complexes:

    • Use specialized crosslinkers optimized for membrane protein complexes

    • Perform blue native PAGE to identify native complexes

    • Consider specialized techniques like MYTH (Membrane Yeast Two-Hybrid) assays

  • Phenotypic analysis:

    • Create gene knockouts and analyze resulting phenotypes

    • Test growth under various environmental stresses

    • Look for changes in membrane permeability, cell morphology, or metabolite profiles

How might post-translational modifications affect UPF0442 protein yjjB function?

Although bacterial proteins typically undergo fewer post-translational modifications (PTMs) than eukaryotic proteins, several modifications could potentially regulate UPF0442 protein yjjB function:

  • Phosphorylation:

    • Bacterial membrane proteins can be regulated by phosphorylation

    • Key residues: Analyze serine, threonine, and tyrosine residues in the sequence

    • Method: Use phospho-specific antibodies or mass spectrometry to detect phosphorylated forms

    • Functional impact: May affect protein-protein interactions or conformational changes

  • Proteolytic processing:

    • Method: Compare apparent molecular weight on SDS-PAGE with predicted weight

    • Technique: N-terminal sequencing to identify processed forms

    • Functional relevance: May activate or inactivate the protein

  • Lipid modifications:

    • Relevant for membrane anchoring or localization to specific membrane domains

    • Methods: Mass spectrometry with specific sample preparation for lipidated proteins

To study these modifications:

  • Compare protein from different growth conditions

  • Use phosphatase treatments to remove modifications

  • Create non-modifiable mutants (e.g., S→A for phosphorylation sites)

  • Perform mass spectrometry analysis optimized for PTM detection

Remember that as a bacterial membrane protein, UPF0442 protein yjjB likely functions within the context of the bacterial cell envelope, potentially interacting with the peptidoglycan layer, outer membrane components, or participating in membrane organization.

What are common challenges in working with recombinant UPF0442 protein yjjB and how can they be addressed?

Membrane proteins like UPF0442 protein yjjB present several research challenges:

  • Expression challenges:

    • Problem: Low expression levels or protein misfolding

    • Solution: Optimize expression conditions (temperature, inducer concentration), use specialized E. coli strains (C41/C43), or test different fusion tags to enhance solubility

  • Extraction difficulties:

    • Problem: Inefficient extraction from membranes

    • Solution: Screen multiple detergents (DDM, LDAO, OG) at various concentrations; consider extraction time and temperature optimization

  • Protein stability issues:

    • Problem: Protein aggregation or degradation

    • Solution: Include appropriate stabilizers (glycerol, specific lipids), optimize buffer components, minimize freeze-thaw cycles

  • Functional assays:

    • Problem: Difficulty in establishing functional readouts for a protein with unknown function

    • Solution: Perform comparative studies with homologous proteins, test multiple potential activities, employ unbiased approaches like metabolomics or interactomics

  • Interaction studies:

    • Problem: False positives or missed interactions

    • Solution: Use multiple complementary methods, include appropriate controls, optimize detergent conditions to maintain native interactions

When troubleshooting recombinant protein work, systematically alter one variable at a time and document all experimental conditions carefully to identify optimal parameters.

How can structural analysis approaches be applied to understand UPF0442 protein yjjB function?

Despite challenges in membrane protein structural analysis, several approaches can provide insights into UPF0442 protein yjjB structure-function relationships:

For initial characterization, focus on determining the protein's topology, oligomeric state, and identification of potential substrate-binding regions through comparison with structurally characterized members of the UPF0442 family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.