Recombinant UPF0442 protein YPO0485/y3689/YP_3694 (YPO0485, y3689, YP_3694)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YPO0485; y3689; YP_3694; UPF0442 protein YPO0485/y3689/YP_3694
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Yersinia pestis
Target Names
YPO0485
Target Protein Sequence
MGVSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIEL ASLVASIMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEALMST MVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV
Uniprot No.

Target Background

Database Links

KEGG: ypk:y3689

STRING: 187410.y3689

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0442 protein YPO0485/y3689/YP_3694?

UPF0442 protein YPO0485/y3689/YP_3694 is a full-length protein comprising 153 amino acids derived from Yersinia pestis. The protein is cataloged in the UniProt database under accession number Q74Q23. The UPF0442 designation indicates it belongs to an uncharacterized protein family, with its function not yet fully elucidated in the scientific literature. The protein is referenced by multiple locus names including YPO0485, y3689, and YP_3694, reflecting different annotation systems used in genomic databases of Y. pestis strains .

How does the UPF0442 protein's structure influence experimental approaches?

While detailed structural data for this specific protein is limited, sequence analysis suggests the UPF0442 protein contains hydrophobic regions characteristic of membrane-associated proteins. These structural features necessitate careful consideration when designing expression systems and purification strategies. Research approaches should account for potential membrane association by employing detergents or membrane mimetics during purification. Additionally, the presence of hydrophobic domains may influence the choice of expression host, with eukaryotic systems potentially offering advantages for proper folding of membrane-associated regions. For structural studies, researchers might consider using truncated constructs focusing on soluble domains if the full-length protein proves challenging to work with .

Which expression systems are most effective for recombinant UPF0442 protein production?

The table below summarizes expression system characteristics:

Expression SystemYieldTurnaround TimePost-translational ModificationsComplexityBest Application
E. coliHighShortMinimalLowStructural studies, antibody generation
YeastMedium-HighMediumModerateMediumFunctional studies requiring some modifications
Insect/BaculovirusMediumLongGoodHighComplex folding requirements
Mammalian (HEK293)Low-MediumLongExcellentHighestStudying native protein function

What tagging strategies enhance purification efficiency for recombinant UPF0442 protein?

Strategic selection of protein tags can dramatically improve both expression and purification outcomes for UPF0442 protein. The most commonly employed tags include:

Polyhistidine (His) tags, typically comprising 6-8 histidine residues, enable efficient purification through immobilized metal affinity chromatography (IMAC). This approach is particularly effective for UPF0442 protein purification, as demonstrated in available recombinant preparations. The His-tagged UPF0442 protein construct permits single-step purification under both native and denaturing conditions, offering flexibility for different experimental needs .

Fluorescent protein fusions, particularly YFP/GFP tags, represent a multifunctional approach that enables both visualization of expression and high-affinity purification. This system employs anti-GFP/YFP nanobody supports for purification, achieving high stringency and selectivity. The fluorescent tag additionally permits real-time monitoring of expression levels and facilitates fluorescence-activated cell sorting (FACS) for isolating high-expressing clones in stable cell line development. Research indicates this approach can yield over 10 mg of purified protein per liter of culture when implemented in HEK293F cells .

FLAG-tag incorporation provides an alternative affinity purification strategy using anti-FLAG M2 affinity gel, demonstrated to be effective for co-immunoprecipitation studies involving tagged proteins. This approach is particularly valuable when investigating protein-protein interactions .

How should an optimal HEK293F expression system be designed for UPF0442 protein production?

Designing an optimal HEK293F expression system for UPF0442 protein requires careful consideration of several factors:

Vector selection should incorporate a strong promoter (typically CMV) and appropriate regulatory elements. The pcDNA 4/TO vector system has demonstrated efficacy in this context, allowing tetracycline-inducible expression for controlled protein production. The construct should include an appropriate signal peptide (such as IFNα2) for secretion, relevant purification tags (His-tag, FLAG-tag, or fluorescent protein fusion), and potentially a protease cleavage site for tag removal .

For transfection, linear polyethylenimine (PEI) demonstrates excellent transfection efficiency with HEK293F cells at a DNA:PEI ratio of approximately 1:2.3 (e.g., 22 μg plasmid DNA to 50 μg PEI). Following transfection, cells should be cultured in serum-containing medium for 16-24 hours before transitioning to serum-free expression medium .

For stable cell line development, selection should be performed using an appropriate antibiotic (e.g., Zeocin at 100 μg/ml) with medium replacement every 2-3 days until resistant colonies emerge. For optimal expression, cells should reach approximately 50% confluence before inducing protein expression in serum-free medium supplemented with tetracycline (3 μg/ml). Medium can be collected every 2-3 days, with typical expression continuing for 10+ days in optimized conditions .

What purification strategy yields the highest purity of recombinant UPF0442 protein?

A multi-step purification strategy is recommended to achieve maximum purity of recombinant UPF0442 protein:

Initial capture is most effectively performed using affinity chromatography matched to the incorporated tag. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) with Ni-NTA resin provides efficient initial capture. Binding should be performed in Tris-based buffer (typically 50 mM Tris, pH 8.0) containing 150-300 mM NaCl and 10-20 mM imidazole. After thorough washing, elution can be performed using 250-300 mM imidazole. For YFP-tagged constructs, anti-GFP/YFP nanobody supports offer exceptional specificity and high recovery rates .

Secondary purification should employ size exclusion chromatography (SEC) to separate monomeric protein from aggregates and remove remaining impurities. A Superdex 200 Increase column operated at 0.4 ml/min flow rate in 50 mM Tris pH 8.0, 150 mM NaCl buffer has proven effective for this purpose. Prior to SEC, protein solutions should be centrifuged at high speed (17,000 rcf, 4°C, 10 min) to remove any aggregates .

For applications requiring exceptional purity, ion exchange chromatography may be incorporated as an intermediate step between affinity capture and SEC, though buffer conditions must be optimized based on the protein's isoelectric point .

What analytical methods should be employed to validate UPF0442 protein identity and purity?

A comprehensive analytical suite should be employed to validate recombinant UPF0442 protein:

SDS-PAGE analysis provides a primary assessment of protein purity and approximate molecular weight. For UPF0442 protein (17.8 kDa), a 12-15% gel is recommended for optimal resolution. Multiple staining methods may be employed, with Coomassie Blue providing general protein visualization and silver staining offering increased sensitivity for detecting low-level contaminants .

Western blotting utilizing antibodies against the protein tag (anti-His, anti-FLAG, or anti-GFP/YFP) confirms the identity of the target protein and can detect degradation products. For comprehensive characterization, mass spectrometry analysis is recommended, with particular emphasis on intact mass measurement to confirm full-length expression and peptide mapping following proteolytic digestion to verify sequence coverage .

For YFP-tagged constructs, fluorescence detection provides an additional validation method, enabling direct visualization of the target protein during purification steps. Quantification of protein concentration should utilize multiple methods, including absorbance at 280 nm (using the calculated extinction coefficient), Bradford or BCA assays, and for fluorescent constructs, fluorescence intensity measurement .

What storage conditions maintain optimal stability of purified UPF0442 protein?

To maintain optimal stability and activity of purified UPF0442 protein, the following storage guidelines should be implemented:

Short-term storage (up to one week) can be accomplished at 4°C in a stabilizing buffer typically comprising 50 mM Tris pH 8.0, 150 mM NaCl. For longer-term storage, the protein should be maintained at -20°C, with 50% glycerol added as a cryoprotectant to prevent freeze-induced damage to protein structure. For extended storage periods, -80°C is recommended for maximum stability .

The protein should be aliquoted into appropriate volumes for single-use applications to avoid repeated freeze-thaw cycles, which significantly accelerate protein degradation. Each freeze-thaw cycle can result in substantial activity loss through denaturation and aggregation. Working aliquots should be maintained at 4°C and used within one week to ensure consistent experimental results .

Prior to use after storage, protein solutions should be centrifuged at high speed (17,000 rcf, 10 min, 4°C) to remove any aggregates that may have formed during storage. For critical applications, size exclusion chromatography may be performed to ensure monodispersity .

How can interaction partners of UPF0442 protein be identified and validated?

Identifying interaction partners of UPF0442 protein requires a multi-faceted approach:

Affinity purification coupled with mass spectrometry (AP-MS) provides a comprehensive strategy for identifying protein interaction networks. This approach utilizes the tagged UPF0442 protein as bait to capture interacting proteins from cellular lysates. For YFP-tagged constructs, anti-GFP/YFP nanobody supports offer exceptional specificity for pull-down experiments. Following stringent washing, the bound proteins can be eluted and identified using mass spectrometry. This method has been successfully applied using FLAG-tagged constructs with anti-FLAG M2 affinity gel for co-immunoprecipitation studies .

Yeast two-hybrid screening offers a complementary approach for detecting direct protein-protein interactions. The UPF0442 protein coding sequence would be cloned into appropriate bait vectors, followed by screening against a prey library derived from Yersinia pestis or other relevant organisms. Positive interactions can be further validated through targeted binary assays .

For validation of specific interactions, microscale thermophoresis (MST) or surface plasmon resonance (SPR) should be employed to determine binding affinities and kinetics. These biophysical techniques require purified recombinant proteins and provide quantitative measurements of interaction strength. Co-localization studies using fluorescently labeled proteins can provide additional evidence for interactions in a cellular context, particularly valuable when using YFP-tagged UPF0442 constructs .

What approaches can elucidate the potential function of UPF0442 protein in Yersinia pestis?

Elucidating the function of UPF0442 protein requires integrating multiple experimental approaches:

Comparative genomics analysis examining the conservation of UPF0442 protein across bacterial species can provide initial insights into functional importance. Regions of high sequence conservation often indicate functional domains. Additionally, examining the genomic context of the YPO0485/y3689/YP_3694 gene may reveal co-regulated genes involved in related pathways .

Structural characterization through X-ray crystallography or cryo-electron microscopy can reveal structural motifs indicative of specific functions. While crystallographic data for this specific protein is not yet available, the recombinant expression systems described provide suitable material for structural studies. For challenging membrane-associated proteins, NMR spectroscopy of isolated domains may offer an alternative approach .

Functional genomics approaches, including gene knockout studies in Yersinia pestis followed by phenotypic characterization, provide direct evidence of biological function. Complementation with recombinant protein can confirm phenotypic observations. Additionally, transcriptomic and proteomic profiling of knockout strains can reveal affected pathways .

Biochemical assays examining potential enzymatic activities should be guided by structural predictions and comparative analysis. Common activities to test include nucleotide binding/hydrolysis, lipid interaction, and signal transduction functions, particularly given the membrane-associated characteristics suggested by sequence analysis .

How can structural studies of UPF0442 protein be optimized for crystallography or cryo-EM?

Optimizing UPF0442 protein for structural studies requires specialized approaches:

Construct design represents the critical first step in structural biology projects. For UPF0442 protein, multiple constructs should be designed with variations in terminal boundaries and flexible region removal. Given the potential membrane association suggested by sequence analysis, constructs focusing on soluble domains may prove more amenable to crystallization. Additionally, fusion partners known to enhance crystallization (such as T4 lysozyme or BRIL) should be considered for challenging constructs .

Expression optimization should emphasize protein quality over quantity. While E. coli systems typically provide the highest yields, eukaryotic expression in insect or mammalian cells may be necessary for proper folding, particularly for constructs containing transmembrane regions. The YFP-fusion system described for HEK293F cells offers advantages through fluorescence-based quality assessment and selection of high-expressing clones .

Purification for structural studies requires exceptional attention to monodispersity. Following affinity purification, size exclusion chromatography is essential for selecting monomeric populations. Dynamic light scattering should be employed to confirm sample homogeneity before crystallization trials. For membrane-associated regions, detergent screening is critical, with typical starting points including DDM, LMNG, or amphipols for maintaining native-like environments .

Crystallization trials should employ sparse matrix screening with and without common additives. For challenging proteins, in situ proteolysis, surface entropy reduction, or co-crystallization with binding partners may enhance crystallization propensity. For cryo-EM studies, grid optimization focusing on sample concentration, buffer conditions, and vitrification parameters represents the key determinant of successful structure determination .

How can low expression yields of recombinant UPF0442 protein be addressed?

Low expression yields of UPF0442 protein can be systematically addressed through multiple strategies:

Expression system optimization should be the initial focus, with systematic comparison of E. coli, yeast, insect, and mammalian systems. For E. coli expression, BL21(DE3) or Rosetta strains address common limitations. If membrane association is limiting soluble expression, specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression should be employed. For eukaryotic systems, HEK293F cells have demonstrated efficacy for challenging proteins using YFP-fusion approaches for selection of high-expressing clones .

Codon optimization for the expression host is essential, particularly for proteins from organisms with divergent codon usage like Yersinia pestis. Commercial gene synthesis with codon optimization for the selected expression host eliminates potential translational limitations. Additionally, optimizing the Kozak sequence for eukaryotic expression can significantly improve translation initiation efficiency .

Culture condition optimization should investigate temperature, induction timing, and media composition. Lower temperature induction (16-18°C) often improves folding efficiency for challenging proteins. For secreted constructs in HEK293F systems, expression in serum-free medium with tetracycline induction has proven effective, with harvest timing optimized through fluorescence monitoring when using YFP-tagged constructs .

For stable cell line development, fluorescence-activated cell sorting (FACS) enables selection of high-expressing clones when using fluorescent protein fusions. This approach can increase yields by more than 10-fold compared to unsorted populations. Additionally, implementing fed-batch cultivation strategies can extend culture duration and increase volumetric productivity .

What strategies can resolve purification challenges with recombinant UPF0442 protein?

Purification challenges with UPF0442 protein can be overcome through multiple complementary approaches:

Solubility enhancement represents a fundamental strategy for proteins with hydrophobic regions. Addition of solubilizing agents such as glycerol (5-10%), low concentrations of non-denaturing detergents (0.01-0.05% Triton X-100), or increased salt concentration (300-500 mM NaCl) can significantly improve solubility during extraction and purification. For membrane-associated regions, detergent screening (DDM, LMNG, CHAPS) is essential for effective solubilization .

Affinity tag optimization can dramatically improve purification outcomes. While His-tags are commonly employed, alternative tags including GST, MBP, or fluorescent protein fusions offer advantages for particular applications. The YFP-fusion approach with anti-GFP/YFP nanobody supports has demonstrated exceptional specificity and recovery for challenging proteins. Dual-tagging strategies combining N-terminal and C-terminal tags can be employed for proteins exhibiting tag accessibility issues .

Optimized buffer systems are critical for maintaining protein stability throughout purification. The standard buffer system of 50 mM Tris pH 8.0, 150 mM NaCl can be supplemented with stabilizing agents including glycerol, reducing agents (DTT, TCEP), and protease inhibitors. For proteins prone to aggregation, addition of non-detergent sulfobetaines (NDSB-201) or arginine can improve monodispersity. Buffer optimization should be guided by differential scanning fluorimetry to identify stabilizing conditions .

For challenging cases, on-column refolding protocols can be implemented during IMAC purification. This approach involves initial denaturation and binding under denaturing conditions (6M guanidine HCl), followed by gradual removal of the denaturant through a decreasing gradient while the protein remains bound to the resin .

How can functional activity of purified UPF0442 protein be validated?

Validating functional activity of UPF0442 protein requires tailored approaches given its uncharacterized nature:

Biophysical characterization provides the foundation for functional validation. Circular dichroism spectroscopy should be employed to confirm proper secondary structure formation. Thermal shift assays can assess protein stability and identify potential ligand interactions through melting temperature shifts. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) confirms the oligomeric state and monodispersity essential for functional studies .

For membrane-associated proteins like UPF0442, membrane interaction assays provide critical functional insights. Liposome binding assays using fluorescently labeled protein can quantify membrane association. Additionally, proteoliposome reconstitution followed by functional assays may reveal transport or signaling functions not evident in solution-based assays .

Interaction validation with predicted binding partners represents a pragmatic approach when specific enzymatic functions remain unknown. Co-immunoprecipitation experiments using tagged UPF0442 protein can identify interaction partners from cellular lysates. For defined interactions, biophysical techniques including surface plasmon resonance, isothermal titration calorimetry, or microscale thermophoresis provide quantitative binding parameters .

In vivo complementation studies provide the most definitive functional validation. Expression of recombinant UPF0442 protein in knockout strains of Yersinia pestis can confirm functional complementation through phenotype rescue. This approach directly connects biochemical properties to biological function in the native context .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.