Recombinant UPF0442 protein YPTB0627 (YPTB0627)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format preference, kindly indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery information, please consult your local distributors.
As a standard practice, all protein shipments are accompanied by normal blue ice packs. If you require dry ice for shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing it for your product.
Synonyms
YPTB0627; UPF0442 protein YPTB0627
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
YPTB0627
Target Protein Sequence
MGVSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIEL ASLVASIMIGVIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEAL MSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV
Uniprot No.

Target Background

Database Links

KEGG: yps:YPTB0627

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0442 protein YPTB0627 and what organism does it originate from?

UPF0442 protein YPTB0627 is a protein encoded by the YPTB0627 gene in Yersinia pseudotuberculosis serotype I. The protein belongs to the UPF0442 protein family, a group of uncharacterized protein families (UPF) where the numerical designation indicates a specific family with unknown function . The protein consists of 156 amino acids and has been assigned the UniProt ID Q66ER4 . As a bacterial protein from a pathogenic species, it represents a potential target for understanding Yersinia biology and pathogenesis mechanisms.

What expression systems are most effective for producing recombinant UPF0442 protein YPTB0627?

E. coli expression systems have proven most effective for the production of recombinant UPF0442 protein YPTB0627. Commercial suppliers consistently use E. coli as the host organism for expression, suggesting it provides optimal yields and functional protein . The protein is typically expressed with an N-terminal His-tag to facilitate purification while maintaining protein functionality .

What purification strategies yield the highest purity for recombinant UPF0442 protein YPTB0627?

The most effective purification strategy for recombinant UPF0442 protein YPTB0627 involves immobilized metal affinity chromatography (IMAC) utilizing the N-terminal His-tag. Commercial preparations report purity levels greater than 90% as determined by SDS-PAGE analysis . A typical purification workflow includes:

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • IMAC purification using Ni-NTA or similar matrices

  • Optional secondary purification steps such as size exclusion chromatography

  • Buffer exchange to remove imidazole and other purification reagents

  • Quality control by SDS-PAGE and potentially mass spectrometry

For researchers requiring ultra-high purity for specialized applications such as structural studies or therapeutic development, additional purification steps might include ion exchange chromatography or hydrophobic interaction chromatography. The final product is typically provided as a lyophilized powder to ensure stability during shipping and storage .

How can researchers optimize protein yield while maintaining functional integrity of UPF0442 protein YPTB0627?

Optimizing protein yield while preserving functional integrity requires careful consideration of expression conditions and downstream processing. Based on commercial production practices, researchers should consider:

  • Expression temperature optimization: Lower temperatures (16-25°C) often reduce inclusion body formation compared to standard 37°C induction.

  • Induction strategy: Testing various IPTG concentrations (0.1-1.0 mM) and induction durations (4-24 hours) to identify optimal conditions.

  • Media composition: Enriched media (such as Terrific Broth) often yields higher biomass than standard LB media.

  • Lysis buffer composition: Inclusion of stabilizing agents like glycerol (5-10%) and appropriate detergents if the protein has membrane-associated properties.

  • Purification under native conditions: When possible, native purification preserves protein folding and activity better than denaturing conditions.

  • Addition of protease inhibitors during purification to prevent degradation.

  • Minimizing freeze-thaw cycles as recommended in the storage guidelines for commercial preparations .

These optimizations must be empirically determined for each specific experimental setup, as small variations in expression constructs or host strains can significantly impact yield and functionality.

What are the optimal storage conditions for maintaining UPF0442 protein YPTB0627 stability?

The optimal storage conditions for UPF0442 protein YPTB0627 include:

  • Long-term storage: -20°C to -80°C with aliquoting to minimize freeze-thaw cycles .

  • Buffer composition: Tris-based buffer with 50% glycerol for liquid formulations or Tris/PBS-based buffer with 6% trehalose at pH 8.0 for lyophilized forms .

  • Short-term working storage: 4°C for up to one week for actively used aliquots .

  • Reconstitution recommendations: For lyophilized protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol to a final concentration of 5-50% (with 50% being recommended by suppliers) before aliquoting for storage .

Multiple sources consistently emphasize the importance of avoiding repeated freeze-thaw cycles, as these can lead to protein denaturation, aggregation, and loss of activity. Implementation of a proper aliquoting strategy immediately after reconstitution is critical for maintaining long-term protein integrity .

How does buffer composition affect the stability and functionality of UPF0442 protein YPTB0627?

Buffer composition significantly impacts the stability and functionality of UPF0442 protein YPTB0627. Based on commercial formulations, the following buffer components play key roles:

  • Buffering agent: Tris-based buffers at pH 8.0 appear optimal for maintaining protein stability, suggesting the protein has better solubility and stability under slightly alkaline conditions .

  • Cryoprotectants: Glycerol (50%) for liquid formulations or trehalose (6%) for lyophilized preparations serve as effective cryoprotectants, preventing protein denaturation during freeze-thaw cycles by disrupting ice crystal formation .

  • Salt concentration: PBS components in some formulations provide physiological ionic strength, which helps maintain proper protein folding and prevents aggregation .

Researchers developing custom buffer compositions should consider these elements while optimizing for their specific experimental requirements. Additionally, compatibility with downstream applications should be evaluated, as high glycerol concentrations may interfere with some assays or structural studies.

What analytical methods are recommended for assessing the quality and integrity of stored UPF0442 protein YPTB0627 samples?

To assess the quality and integrity of stored UPF0442 protein YPTB0627 samples, researchers should employ multiple analytical techniques:

  • SDS-PAGE: For monitoring protein purity, potential degradation, and aggregation. Commercial preparations typically report >90% purity using this method .

  • Size Exclusion Chromatography (SEC): To evaluate protein oligomeric state and detect potential aggregation that may occur during storage.

  • Activity assays: Though specific functional assays for UPF0442 protein YPTB0627 are not detailed in the available information, researchers should develop appropriate functional assays based on predicted protein activities or interaction partners.

  • Circular Dichroism (CD): To assess secondary structure integrity and proper folding after storage or buffer exchange.

  • Dynamic Light Scattering (DLS): To detect protein aggregation and evaluate size distribution of protein particles in solution.

  • Mass Spectrometry: For precise molecular weight determination and detection of potential post-translational modifications or degradation products.

Implementing a quality control workflow that incorporates multiple methods provides comprehensive assessment of protein integrity, especially important for samples subjected to extended storage or multiple freeze-thaw cycles.

What are the predicted functional domains and transmembrane regions in UPF0442 protein YPTB0627?

Analysis of the amino acid sequence of UPF0442 protein YPTB0627 reveals several potential functional domains and transmembrane regions. The sequence pattern suggests this protein likely functions as a transmembrane protein with multiple membrane-spanning domains . Key features include:

  • Hydrophobic stretches consistent with transmembrane helices, particularly in regions containing sequences rich in leucine, isoleucine, valine, and alanine residues.

  • Potential cytoplasmic and extracellular domains containing more hydrophilic residues.

  • The presence of conserved motifs such as "WIPGLWLYRK" near the C-terminus that are preserved across homologs in different bacterial species, suggesting functional importance.

While specific biochemical functions remain uncharacterized (hence the UPF designation), structural predictions based on the amino acid sequence suggest potential roles in membrane transport, signaling, or maintaining membrane integrity. Advanced structural prediction tools and comparison with better-characterized homologs can provide further insights into functional domains and potential binding sites .

How can researchers investigate potential protein-protein interactions involving UPF0442 protein YPTB0627?

Investigating protein-protein interactions involving UPF0442 protein YPTB0627 requires a multi-faceted approach:

  • Yeast Two-Hybrid (Y2H) screening: Using YPTB0627 as bait against a Yersinia pseudotuberculosis genomic library to identify potential interaction partners.

  • Pull-down assays: Utilizing the His-tagged recombinant protein to capture interaction partners from bacterial lysates, followed by mass spectrometry identification.

  • Co-immunoprecipitation (Co-IP): Using antibodies against YPTB0627 or potential interaction partners to verify interactions in native context.

  • Biolayer interferometry or surface plasmon resonance: For quantitative analysis of binding kinetics with candidate interaction partners.

  • Bacterial two-hybrid systems: As an alternative to Y2H that may better represent the bacterial cellular environment.

  • Proximity labeling approaches: Such as BioID or APEX2 fusions to identify proteins in close proximity to YPTB0627 in living cells.

  • Cross-linking mass spectrometry (XL-MS): To capture transient or weak interactions through chemical cross-linking followed by mass spectrometry analysis.

These complementary approaches can provide a comprehensive understanding of the protein interaction network involving YPTB0627, potentially revealing its functional role in Yersinia biology .

What role might UPF0442 protein YPTB0627 play in Yersinia pseudotuberculosis pathogenesis?

The potential role of UPF0442 protein YPTB0627 in Yersinia pseudotuberculosis pathogenesis remains speculative based on current information, but several lines of evidence suggest possible functions:

  • As a predicted membrane protein, it may participate in host-pathogen interactions, potentially mediating adhesion, invasion, or immune evasion.

  • The protein could function in membrane transport systems essential for bacterial survival within host environments, such as nutrient acquisition or efflux of antimicrobial compounds.

  • It might participate in signaling pathways that regulate virulence factor expression in response to environmental cues encountered during infection.

  • The conserved nature of UPF0442 proteins across bacterial species suggests a fundamental biological role that could be essential for bacterial fitness during infection.

Research approaches to investigate these possibilities include:

  • Creating gene knockout or knockdown strains to assess effects on virulence in infection models.

  • Transcriptomic analysis to determine if YPTB0627 expression is regulated during different stages of infection.

  • Localization studies using fluorescent protein fusions to determine subcellular distribution during host interaction.

  • Comparative genomic analysis across Yersinia strains with different virulence profiles to identify potential correlations with YPTB0627 sequence variations.

Such investigations could reveal whether YPTB0627 represents a potential therapeutic target for addressing Yersinia infections .

What control proteins should be included when designing experiments with UPF0442 protein YPTB0627?

When designing experiments with UPF0442 protein YPTB0627, appropriate control proteins should be selected based on the experimental context:

  • Homologous proteins: Including the E. coli homolog yjjB (UniProt: P0ADD2) or homologs from other Yersinia species provides useful comparisons for functional or structural studies .

  • Negative controls: Non-related proteins with similar molecular weight and biochemical properties (solubility, isoelectric point) but without expected activity in the system under study.

  • Tag-only controls: Proteins with identical tags (His-tag) but unrelated sequences to control for tag-specific effects in binding or functional assays.

  • Mutated versions: Site-directed mutants of YPTB0627 targeting predicted functional residues to establish structure-function relationships.

  • Heat-inactivated YPTB0627: To distinguish between specific biochemical activities and non-specific binding effects.

The choice of controls should be tailored to the specific experimental questions being addressed, ensuring that observed effects can be confidently attributed to the specific properties of YPTB0627 rather than experimental artifacts or non-specific interactions .

How can researchers validate antibodies for specific detection of UPF0442 protein YPTB0627?

Validating antibodies for specific detection of UPF0442 protein YPTB0627 requires a systematic approach:

  • Initial specificity testing:

    • Western blot against purified recombinant YPTB0627 and whole cell lysates

    • Inclusion of negative controls (knockout strains or unrelated bacterial species)

    • Competition assays with excess purified protein to demonstrate specific binding

  • Cross-reactivity assessment:

    • Testing against closely related homologs, particularly from other Yersinia species

    • Evaluation in complex biological samples where multiple potential cross-reactive proteins exist

  • Application-specific validation:

    • For immunoprecipitation: Verification of target enrichment by mass spectrometry

    • For immunofluorescence: Colocalization with known subcellular markers or GFP-tagged versions

    • For ELISA: Standard curve generation with purified protein and determination of detection limits

  • Batch-to-batch consistency:

    • Regular testing of new antibody lots against reference standards

    • Maintenance of positive control samples with established staining patterns

This comprehensive validation approach ensures reliable detection of YPTB0627 in experimental systems, reducing the risk of misinterpreting results due to antibody cross-reactivity or non-specific binding .

What considerations are important when designing structural studies of UPF0442 protein YPTB0627?

Designing structural studies for UPF0442 protein YPTB0627 requires careful consideration of several factors:

  • Protein preparation challenges:

    • As a predicted membrane protein, standard structural biology techniques may be challenging

    • Detergent screening to identify optimal solubilization conditions

    • Consideration of lipid nanodiscs or amphipols as alternatives to detergents

    • Evaluation of construct design, potentially removing flexible regions or creating fusion proteins to aid crystallization

  • Method selection based on protein characteristics:

    • X-ray crystallography: Requires high-purity, homogeneous samples capable of forming crystals

    • Cryo-electron microscopy: Increasingly powerful for membrane proteins, particularly in lipid environments

    • NMR spectroscopy: Challenging for large membrane proteins but useful for dynamics studies of specific domains

    • Small-angle X-ray scattering (SAXS): For low-resolution structural information in solution

  • Protein stability considerations:

    • Buffer optimization to enhance long-term stability during structural studies

    • Thermal stability assays to identify stabilizing ligands or conditions

    • Evaluation of protein homogeneity by size exclusion chromatography prior to structural studies

  • Integrative structural biology approaches:

    • Combining multiple structural techniques for comprehensive characterization

    • Computational modeling and molecular dynamics simulations to complement experimental data

    • Evolutionary coupling analysis to predict contacts between amino acid residues

These considerations address the specific challenges associated with structural studies of membrane proteins like YPTB0627, increasing the likelihood of successful structure determination .

What genomic approaches could elucidate the function of UPF0442 protein YPTB0627 in Yersinia pseudotuberculosis?

Several genomic approaches could help elucidate the function of UPF0442 protein YPTB0627:

  • Comparative genomics:

    • Analysis of gene conservation, synteny, and evolutionary patterns across Yersinia species and other bacteria

    • Identification of co-evolved gene clusters that might suggest functional relationships

  • Transcriptomic analysis:

    • RNA-seq under various growth conditions and stress responses to identify expression patterns

    • Dual RNA-seq during host infection to determine if YPTB0627 is differentially expressed during pathogenesis

  • Functional genomics:

    • CRISPR interference or transposon mutagenesis screens to assess the phenotypic impact of YPTB0627 disruption

    • Suppressor screens to identify genetic interactions that compensate for YPTB0627 loss

  • Regulatory network analysis:

    • ChIP-seq to identify transcription factors binding near the YPTB0627 gene

    • Promoter analysis and reporter gene assays to characterize regulatory elements

  • Phylogenetic profiling:

    • Identification of genes with similar phylogenetic distributions across bacterial species, which often indicates functional relationships

These approaches can provide valuable insights into the biological context of YPTB0627 function, potentially revealing its role in specific cellular processes or stress responses relevant to Yersinia biology and pathogenesis .

How can systems biology approaches be applied to understand UPF0442 protein YPTB0627 in the context of bacterial cellular networks?

Systems biology approaches offer powerful tools for understanding UPF0442 protein YPTB0627 within bacterial cellular networks:

  • Multi-omics integration:

    • Combining proteomics, metabolomics, and transcriptomics data from wild-type and YPTB0627 mutant strains

    • Correlation analysis to identify metabolic pathways or cellular processes affected by YPTB0627 disruption

  • Protein-protein interaction network mapping:

    • Affinity purification mass spectrometry to identify physical interaction partners

    • Construction of interaction networks to place YPTB0627 within cellular pathways

  • Flux balance analysis and metabolic modeling:

    • Integration of YPTB0627 function into genome-scale metabolic models

    • Prediction of metabolic consequences of YPTB0627 perturbation

  • Network perturbation analysis:

    • Systematic genetic interaction mapping through double-mutant analysis

    • Chemical genetic profiling to identify compounds with differential effects on YPTB0627 mutants

  • Computational prediction of function:

    • Machine learning approaches integrating multiple data types to predict protein function

    • Structural systems biology to predict functional sites based on protein structure

These systems-level approaches can reveal emergent properties not evident from reductionist studies, placing YPTB0627 within the broader context of bacterial physiology and potentially identifying unexpected functional connections .

What potential applications exist for UPF0442 protein YPTB0627 in biotechnology or therapeutic development?

Several potential applications for UPF0442 protein YPTB0627 in biotechnology and therapeutic development warrant investigation:

  • Antimicrobial target development:

    • If essential for bacterial viability or virulence, YPTB0627 could represent a novel target for antimicrobial development

    • Structure-based drug design targeting YPTB0627-specific features not present in host proteins

    • High-throughput screening for inhibitors of YPTB0627 function or interactions

  • Diagnostic applications:

    • Development of specific antibodies or aptamers for detecting Yersinia pseudotuberculosis in clinical or environmental samples

    • Incorporation into multiplexed diagnostic platforms for pathogen identification

  • Vaccine development:

    • Evaluation as a potential vaccine antigen if exposed on the bacterial surface

    • Assessment of protective immunity in animal models of Yersinia infection

  • Biotechnological applications:

    • If found to have unique biochemical properties, potential use in protein engineering applications

    • Membrane protein expression system development if YPTB0627 displays favorable expression characteristics

  • Research tools:

    • Development of fluorescent protein fusions for studying bacterial membrane dynamics

    • Creation of biosensors based on YPTB0627 structure or function

These applications depend on further characterization of YPTB0627's structure, function, and biological significance, highlighting the importance of continued basic research into this uncharacterized protein family .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.