fxsA interacts with the F-plasmid-encoded PifA protein to alleviate phage exclusion. Overexpression of fxsA enables T7 phage to infect F-plasmid-containing E. coli cells more efficiently, though with reduced burst sizes (~50% of F⁻-strain levels) .
fxsA modulates T7 infection by sequestering PifA at the cytoplasmic membrane, preventing membrane damage and exclusion . The fourth transmembrane segment of fxsA is critical for this interaction, while the C-terminal tail is dispensable .
PifA binding: Direct interaction with fxsA reduces membrane disruption caused by T7 infection.
Membrane localization: Anchoring of PifA limits its cytoplasmic availability, thereby suppressing exclusion .
fxsA belongs to the UPF0716 protein family, with orthologs identified in diverse bacterial species. These orthologs share conserved structural motifs, suggesting functional homology.
| Organism | Protein ID | Gene Name | Bitscore | Function |
|---|---|---|---|---|
| Geobacter sulfurreducens | Q74F04 | fxsA | 76 | Cytoplasmic membrane protein |
| Halococcus saccharolyticus | M0MN30 | fxsA | 68 | Phage T7 F exclusion suppressor |
| Vibrio furnissii | A0A0Q2MFT9 | fxsA | 114 | Exclusion suppressor |
| Salinisphaera japonica | A0A423PU67 | fxsA | 91 | Exclusion protein |
Data derived from InParanoid ortholog groups .
Recombinant fxsA is synthesized in E. coli and purified for research use. It is available as:
ELISA-grade protein: Used to study antibody interactions or protein function in vitro .
Tagged variants: May include His-tags or GST-tags for affinity purification.
| Parameter | Specification |
|---|---|
| Source | E. coli (strain K12) |
| Purity | >95% (SDS-PAGE) |
| Storage Buffer | Tris-based buffer, 50% glycerol |
| Storage Temperature | -20°C (stable for >1 year) |
F exclusion suppression: Overexpression of fxsA enables T7 phage to infect F⁺ cells, highlighting its potential in phage therapy or biotechnology .
Membrane interaction: The fourth transmembrane segment is indispensable for suppressing exclusion, as deletion mutants fail to rescue T7 growth .
Cell-free systems: fxsA has been identified in E. coli cell-free extracts, suggesting its role in maintaining membrane integrity during in vitro protein synthesis .
FxsA is a cytoplasmic membrane protein found in bacteria such as Escherichia coli that functions as a suppressor of F exclusion of bacteriophage T7 . The protein alleviates the exclusion of T7 phage in cells harboring the F plasmid, allowing the phage to form plaques with normal efficiency even though the burst size is reduced to approximately half that obtained in F- strains . It's classified as part of the UPF0716 protein family, indicating it was previously a protein of unknown function that has been partially characterized .
The protein contains membrane-spanning domains and is integrated into the bacterial cytoplasmic membrane, suggesting its role in membrane-related processes . Structurally, E. coli FxsA consists of 158 amino acids with multiple transmembrane regions that anchor it within the cell membrane .
The FxsA protein shows notable sequence conservation across different bacterial species while maintaining species-specific variations. Below is a comparison of the amino acid sequences from E. coli and Serratia marcescens:
| Species | Length | Amino Acid Sequence (partial) | UniProt ID |
|---|---|---|---|
| E. coli K12 | 158 aa | MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQKMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSRMPGGGFSAGTGGGNTFDGEYQRKDDERDRLDHKDDRQD | P37147 |
| S. marcescens | 139 aa | MRWLPLLLIFLLAYIEISIFIKVAAVLGVAVTLLLVVFSSCVGISLVRNQGMKTFVQMQQKLAAGESPAAEMVKSVSLVLAGFLLLIPGFFTDFLGLLLLLPPVQKSLTLKLMPHLSVYRPGGWTGGDAANGNTFDGEF | P37148 |
The sequences show high conservation in the N-terminal region with variations in the C-terminal domain . These differences may reflect adaptation to species-specific membrane environments or phage interactions.
For efficient expression of recombinant FxsA, researchers should consider the following protocol:
Expression System Selection: E. coli expression systems are most commonly used due to the protein's bacterial origin. BL21(DE3) or similar strains are recommended for membrane protein expression .
Temperature Optimization: Lower temperatures (16-25°C) during induction help prevent inclusion body formation, which is crucial for membrane proteins .
Induction Parameters:
IPTG concentration: 0.1-0.5 mM
Induction time: 4-16 hours (longer at lower temperatures)
OD600 at induction: 0.6-0.8
Buffer Composition for Extraction:
Researchers should validate expression using Western blot analysis with anti-FxsA antibodies or antibodies against fusion tags if the protein is expressed as a fusion construct .
Purification of recombinant FxsA protein requires specialized approaches due to its membrane-associated nature:
Membrane Fraction Isolation:
Cell lysis via sonication or French press
Differential centrifugation to isolate membrane fractions (30,000-100,000 × g)
Solubilization using appropriate detergents (DDM, LDAO, or Triton X-100)
Chromatography Sequence:
Affinity chromatography (if tagged): Ni-NTA for His-tagged constructs
Ion exchange chromatography: SP or Q Sepharose depending on pH
Size exclusion chromatography: Final polishing step
Storage Conditions:
The purified protein should be evaluated for purity by SDS-PAGE and for activity through functional assays such as bacteriophage protection assays .
To elucidate the mechanism of FxsA-mediated resistance to phage T7 in F+ cells, researchers should employ a multi-faceted approach:
Gene Expression Analysis:
Quantify fxsA expression levels using RT-qPCR
Compare expression in F+ and F- cells
Examine expression during different phases of phage infection
Protein-Protein Interaction Studies:
Co-immunoprecipitation to identify potential binding partners
Bacterial two-hybrid assays for membrane protein interactions
Cross-linking experiments followed by mass spectrometry
Functional Assays:
Structural Studies:
Cryo-electron microscopy of membrane fractions
NMR studies of purified protein in detergent micelles
The experimental evidence suggests that FxsA does not prevent phage DNA synthesis but partially inhibits late protein synthesis, which provides clues to its mechanism of action .
While direct evidence linking FxsA to bacterial persistence is limited in the provided search results, research on membrane proteins and bacterial persistence suggests potential connections:
Membrane Potential Regulation:
Stress Response Integration:
Experimental Approaches to Investigate this Relationship:
Researchers could use label-free quantitative proteomics similar to those employed in persister studies to determine if FxsA levels change during antibiotic challenge and recovery .
When conducting research with recombinant FxsA protein, researchers must adhere to biosafety regulations, particularly those outlined in the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules :
Biosafety Level Assessment:
Institutional Requirements:
Laboratory Practices:
Standard microbiological practices (hand washing, no eating/drinking)
Proper decontamination of work surfaces
Appropriate waste disposal
Failure to comply with these guidelines could result in suspension or termination of NIH funding for research involving recombinant or synthetic nucleic acid molecules .
Membrane proteins like FxsA often present challenges during recombinant expression. Here are methodological approaches to overcome common issues:
Poor Expression Yields:
Optimize codon usage for the expression host
Test different promoter systems (T7, tac, araBAD)
Adjust induction parameters (temperature, time, inducer concentration)
Consider specialized E. coli strains designed for membrane protein expression (C41, C43)
Inclusion Body Formation:
Reduce expression temperature to 16-20°C
Use lower inducer concentrations
Co-express with molecular chaperones (GroEL/ES, DnaK/J)
Consider fusion partners that enhance solubility (MBP, SUMO)
Extraction and Solubilization Issues:
Screen multiple detergents (DDM, LDAO, OG, CHAPS, etc.)
Test detergent concentration and buffer composition
Consider membrane scaffold proteins for nanodiscs
Evaluate amphipols as alternatives to detergents
Stability Problems During Storage:
A systematic approach to optimization, potentially using Design of Experiments (DoE) methodology, can efficiently identify optimal conditions for FxsA expression and purification.
Several promising research directions could advance our understanding of FxsA protein:
Structural Characterization:
High-resolution structure determination using cryo-EM or X-ray crystallography
Mapping of functional domains through site-directed mutagenesis
Identification of critical residues for membrane integration and function
Interaction Networks:
Comprehensive interactome analysis to identify protein partners
Investigation of potential interactions with bacteriophage proteins
Study of FxsA's role in broader membrane protein complexes
Evolutionary Analysis:
Comparative genomics of fxsA across bacterial species
Evolution of phage resistance mechanisms involving fxsA
Selective pressures driving fxsA conservation and variation
Biotechnological Applications:
Potential use in phage resistance engineering
Applications in synthetic biology for controlled phage sensitivity
Development of FxsA-based biosensors for phage detection
Broader Biological Roles:
These research directions could significantly enhance our understanding of bacterial-phage interactions and potentially reveal new strategies for controlling bacterial infections.