Recombinant UPF0716 protein fxsA (fxsA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Defense

fxsA interacts with the F-plasmid-encoded PifA protein to alleviate phage exclusion. Overexpression of fxsA enables T7 phage to infect F-plasmid-containing E. coli cells more efficiently, though with reduced burst sizes (~50% of F⁻-strain levels) .

Key Functional Insights:

ParameterObservationSource
Plaque formationNormal efficiency despite F plasmid presence
Burst sizeReduced to ~50% of F⁻-strain levels
Late protein synthesisPartially inhibited
Cell leakinessReduced compared to wild-type F⁺ cells

Mechanism of Action

fxsA modulates T7 infection by sequestering PifA at the cytoplasmic membrane, preventing membrane damage and exclusion . The fourth transmembrane segment of fxsA is critical for this interaction, while the C-terminal tail is dispensable .

Key Interactions:

  • PifA binding: Direct interaction with fxsA reduces membrane disruption caused by T7 infection.

  • Membrane localization: Anchoring of PifA limits its cytoplasmic availability, thereby suppressing exclusion .

Orthologs and Evolutionary Conservation

fxsA belongs to the UPF0716 protein family, with orthologs identified in diverse bacterial species. These orthologs share conserved structural motifs, suggesting functional homology.

OrganismProtein IDGene NameBitscoreFunction
Geobacter sulfurreducensQ74F04fxsA76Cytoplasmic membrane protein
Halococcus saccharolyticusM0MN30fxsA68Phage T7 F exclusion suppressor
Vibrio furnissiiA0A0Q2MFT9fxsA114Exclusion suppressor
Salinisphaera japonicaA0A423PU67fxsA91Exclusion protein

Data derived from InParanoid ortholog groups .

Recombinant Production and Applications

Recombinant fxsA is synthesized in E. coli and purified for research use. It is available as:

  • ELISA-grade protein: Used to study antibody interactions or protein function in vitro .

  • Tagged variants: May include His-tags or GST-tags for affinity purification.

Production Details (ELISA Kit):

ParameterSpecification
SourceE. coli (strain K12)
Purity>95% (SDS-PAGE)
Storage BufferTris-based buffer, 50% glycerol
Storage Temperature-20°C (stable for >1 year)

Research Findings and Implications

  1. F exclusion suppression: Overexpression of fxsA enables T7 phage to infect F⁺ cells, highlighting its potential in phage therapy or biotechnology .

  2. Membrane interaction: The fourth transmembrane segment is indispensable for suppressing exclusion, as deletion mutants fail to rescue T7 growth .

  3. Cell-free systems: fxsA has been identified in E. coli cell-free extracts, suggesting its role in maintaining membrane integrity during in vitro protein synthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
fxsA; UPF0716 protein FxsA; Suppressor of F exclusion of phage T7; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Serratia marcescens
Target Names
fxsA
Target Protein Sequence
MRWLPLLLIFLLAYIEISIFIKVAAVLGVAVTLLLVVFSSCVGISLVRNQGMKTFVQMQQ KLAAGESPAAEMVKSVSLVLAGFLLLIPGFFTDFLGLLLLLPPVQKSLTLKLMPHLSVYR PGGWTGGDAANGNTFDGEF
Uniprot No.

Target Background

Protein Families
UPF0716 (FxsA) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0716 protein fxsA and what is its biological role?

FxsA is a cytoplasmic membrane protein found in bacteria such as Escherichia coli that functions as a suppressor of F exclusion of bacteriophage T7 . The protein alleviates the exclusion of T7 phage in cells harboring the F plasmid, allowing the phage to form plaques with normal efficiency even though the burst size is reduced to approximately half that obtained in F- strains . It's classified as part of the UPF0716 protein family, indicating it was previously a protein of unknown function that has been partially characterized .

The protein contains membrane-spanning domains and is integrated into the bacterial cytoplasmic membrane, suggesting its role in membrane-related processes . Structurally, E. coli FxsA consists of 158 amino acids with multiple transmembrane regions that anchor it within the cell membrane .

How does the amino acid sequence differ between FxsA proteins from different bacterial species?

The FxsA protein shows notable sequence conservation across different bacterial species while maintaining species-specific variations. Below is a comparison of the amino acid sequences from E. coli and Serratia marcescens:

SpeciesLengthAmino Acid Sequence (partial)UniProt ID
E. coli K12158 aaMRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQKMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSRMPGGGFSAGTGGGNTFDGEYQRKDDERDRLDHKDDRQDP37147
S. marcescens139 aaMRWLPLLLIFLLAYIEISIFIKVAAVLGVAVTLLLVVFSSCVGISLVRNQGMKTFVQMQQKLAAGESPAAEMVKSVSLVLAGFLLLIPGFFTDFLGLLLLLPPVQKSLTLKLMPHLSVYRPGGWTGGDAANGNTFDGEFP37148

The sequences show high conservation in the N-terminal region with variations in the C-terminal domain . These differences may reflect adaptation to species-specific membrane environments or phage interactions.

What are the optimal conditions for expressing recombinant FxsA protein?

For efficient expression of recombinant FxsA, researchers should consider the following protocol:

  • Expression System Selection: E. coli expression systems are most commonly used due to the protein's bacterial origin. BL21(DE3) or similar strains are recommended for membrane protein expression .

  • Temperature Optimization: Lower temperatures (16-25°C) during induction help prevent inclusion body formation, which is crucial for membrane proteins .

  • Induction Parameters:

    • IPTG concentration: 0.1-0.5 mM

    • Induction time: 4-16 hours (longer at lower temperatures)

    • OD600 at induction: 0.6-0.8

  • Buffer Composition for Extraction:

    • Base buffer: Tris-based buffer with 50% glycerol

    • pH range: 7.5-8.0

    • Salt concentration: 100-300 mM NaCl

    • Detergent: Mild non-ionic detergents like DDM or LDAO for membrane protein solubilization

Researchers should validate expression using Western blot analysis with anti-FxsA antibodies or antibodies against fusion tags if the protein is expressed as a fusion construct .

What purification strategies yield the highest purity of recombinant FxsA?

Purification of recombinant FxsA protein requires specialized approaches due to its membrane-associated nature:

  • Membrane Fraction Isolation:

    • Cell lysis via sonication or French press

    • Differential centrifugation to isolate membrane fractions (30,000-100,000 × g)

    • Solubilization using appropriate detergents (DDM, LDAO, or Triton X-100)

  • Chromatography Sequence:

    • Affinity chromatography (if tagged): Ni-NTA for His-tagged constructs

    • Ion exchange chromatography: SP or Q Sepharose depending on pH

    • Size exclusion chromatography: Final polishing step

  • Storage Conditions:

    • Store at -20°C or -80°C in Tris-based buffer with 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

The purified protein should be evaluated for purity by SDS-PAGE and for activity through functional assays such as bacteriophage protection assays .

How can researchers investigate the mechanism of FxsA-mediated phage resistance?

To elucidate the mechanism of FxsA-mediated resistance to phage T7 in F+ cells, researchers should employ a multi-faceted approach:

  • Gene Expression Analysis:

    • Quantify fxsA expression levels using RT-qPCR

    • Compare expression in F+ and F- cells

    • Examine expression during different phases of phage infection

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify potential binding partners

    • Bacterial two-hybrid assays for membrane protein interactions

    • Cross-linking experiments followed by mass spectrometry

  • Functional Assays:

    • Phage plaque assays comparing wild-type and fxsA mutant strains

    • Measurement of phage DNA synthesis and late protein synthesis

    • Cell leakiness assays, which is a feature of F+ cells abortively infected by T7

  • Structural Studies:

    • Cryo-electron microscopy of membrane fractions

    • NMR studies of purified protein in detergent micelles

The experimental evidence suggests that FxsA does not prevent phage DNA synthesis but partially inhibits late protein synthesis, which provides clues to its mechanism of action .

What is the relationship between FxsA and bacterial persistence?

While direct evidence linking FxsA to bacterial persistence is limited in the provided search results, research on membrane proteins and bacterial persistence suggests potential connections:

  • Membrane Potential Regulation:

    • As a membrane protein, FxsA may influence membrane potential

    • Membrane depolarization has been linked to persister formation through toxins like TisB

  • Stress Response Integration:

    • Phage resistance mechanisms often overlap with stress responses

    • Proteomics studies have identified membrane proteins involved in recovery from antibiotic persistence

  • Experimental Approaches to Investigate this Relationship:

    • Generate fxsA knockout strains and measure persistence rates

    • Perform persistence assays with FxsA overexpression

    • Combine with persister models like TisB-dependent persisters to assess interactions

Researchers could use label-free quantitative proteomics similar to those employed in persister studies to determine if FxsA levels change during antibiotic challenge and recovery .

What biosafety considerations apply when working with recombinant FxsA?

When conducting research with recombinant FxsA protein, researchers must adhere to biosafety regulations, particularly those outlined in the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules :

  • Biosafety Level Assessment:

    • Work with E. coli K-12 strains typically requires BSL-1 containment

    • Experiments involving cloning of genes into E. coli K-12 are described in Appendix F-II of the NIH Guidelines

  • Institutional Requirements:

    • Institutional Biosafety Committee (IBC) approval may be required

    • All recombinant DNA work must comply with NIH Guidelines if the institution receives any NIH funding for such research

    • Even single projects with NIH funding require compliance for all recombinant nucleic acid work at the institution

  • Laboratory Practices:

    • Standard microbiological practices (hand washing, no eating/drinking)

    • Proper decontamination of work surfaces

    • Appropriate waste disposal

Failure to comply with these guidelines could result in suspension or termination of NIH funding for research involving recombinant or synthetic nucleic acid molecules .

How can researchers address poor expression or solubility of recombinant FxsA?

Membrane proteins like FxsA often present challenges during recombinant expression. Here are methodological approaches to overcome common issues:

  • Poor Expression Yields:

    • Optimize codon usage for the expression host

    • Test different promoter systems (T7, tac, araBAD)

    • Adjust induction parameters (temperature, time, inducer concentration)

    • Consider specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Inclusion Body Formation:

    • Reduce expression temperature to 16-20°C

    • Use lower inducer concentrations

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Consider fusion partners that enhance solubility (MBP, SUMO)

  • Extraction and Solubilization Issues:

    • Screen multiple detergents (DDM, LDAO, OG, CHAPS, etc.)

    • Test detergent concentration and buffer composition

    • Consider membrane scaffold proteins for nanodiscs

    • Evaluate amphipols as alternatives to detergents

  • Stability Problems During Storage:

    • Add stabilizing agents (glycerol, specific lipids)

    • Store in smaller aliquots to avoid freeze-thaw cycles

    • Consider lyophilization for long-term storage

A systematic approach to optimization, potentially using Design of Experiments (DoE) methodology, can efficiently identify optimal conditions for FxsA expression and purification.

What are the promising areas for future research on FxsA protein?

Several promising research directions could advance our understanding of FxsA protein:

  • Structural Characterization:

    • High-resolution structure determination using cryo-EM or X-ray crystallography

    • Mapping of functional domains through site-directed mutagenesis

    • Identification of critical residues for membrane integration and function

  • Interaction Networks:

    • Comprehensive interactome analysis to identify protein partners

    • Investigation of potential interactions with bacteriophage proteins

    • Study of FxsA's role in broader membrane protein complexes

  • Evolutionary Analysis:

    • Comparative genomics of fxsA across bacterial species

    • Evolution of phage resistance mechanisms involving fxsA

    • Selective pressures driving fxsA conservation and variation

  • Biotechnological Applications:

    • Potential use in phage resistance engineering

    • Applications in synthetic biology for controlled phage sensitivity

    • Development of FxsA-based biosensors for phage detection

  • Broader Biological Roles:

    • Investigation of potential roles beyond phage resistance

    • Possible functions in stress responses or membrane integrity

    • Connection to bacterial persistence and antibiotic tolerance mechanisms

These research directions could significantly enhance our understanding of bacterial-phage interactions and potentially reveal new strategies for controlling bacterial infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.