Recombinant UPF0721 transmembrane protein yfcA (yfcA)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0721 Transmembrane Protein yfcA

UPF0721 transmembrane protein yfcA, commonly referred to as yfcA, is a protein encoded by the yfcA gene in Escherichia coli. The designation "UPF" (Uncharacterized Protein Family) indicates that this protein belongs to a category whose functions have not been fully characterized through experimental methods. Based on sequence analysis and structural predictions, the protein is classified as a "probable membrane transporter protein," suggesting its potential involvement in the transport of substances across the bacterial cell membrane.

According to the available information, the protein is identified by UniProt IDs P0AD30 and P0AD31, depending on the specific variant or strain of origin. It is synonymously referred to as "yfcA; b2327; JW2324; Probable membrane transporter protein YfcA" or "yfcA; c2873; Probable membrane transporter protein YfcA" . The existence of multiple identifiers suggests variant forms of the protein that may be present in different strains of E. coli or possess slight differences in sequence or function.

As a membrane protein, yfcA likely plays an essential role in cellular processes involving molecular transport across the bacterial cell membrane. The recombinant form of this protein provides researchers with a purified tool for investigating these functions, potentially contributing to our understanding of bacterial physiology and identifying novel targets for antimicrobial development.

Expression System

The recombinant UPF0721 transmembrane protein yfcA is produced through expression in E. coli systems . E. coli represents one of the most widely used prokaryotic expression systems for protein production due to several significant advantages:

  1. Rapid growth kinetics and capacity to achieve high cell density cultures

  2. Well-characterized genetics and availability of diverse expression vectors

  3. Relatively simple and cost-effective cultivation requirements

  4. Capacity for high protein yields

Protein Tagging and Purification

The recombinant yfcA protein features an N-terminal polyhistidine tag (His-tag) . This tag serves multiple critical functions in the production and application of the recombinant protein:

  1. Facilitates efficient protein purification through immobilized metal affinity chromatography (IMAC)

  2. Enables protein detection using anti-His antibodies in Western blotting and other immunological techniques

  3. May contribute to improved protein solubility and stability during purification and storage

Similar tagging approaches have been employed for other recombinant proteins expressed in E. coli. For example, a polyhistidine-tagged Yellow Fever Virus capsid protein (His-YFC) was expressed and purified from E. coli for functional studies related to RNA silencing mechanisms . This demonstrates the versatility and utility of His-tagging for diverse recombinant proteins.

The purification process results in recombinant yfcA with greater than 90% purity as determined by SDS-PAGE analysis , making it suitable for various research applications requiring high-purity protein preparations.

Reconstitution Protocol

The recommended protocol for reconstituting the lyophilized protein includes several critical steps to ensure optimal protein recovery and activity:

  1. Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% and aliquot for long-term storage at -20°C/-80°C

  4. The default recommended final concentration of glycerol is 50%

The addition of glycerol serves as a cryoprotectant, preventing damage to the protein during freezing and thawing cycles by inhibiting ice crystal formation that could disrupt protein structure. The specific buffer composition (Tris/PBS-based buffer with 6% Trehalose at pH 8.0) has been optimized to maintain protein stability during storage.

It is explicitly noted that repeated freezing and thawing is not recommended, as these cycles can lead to protein denaturation and loss of functional activity . Instead, preparing smaller working aliquots for short-term use at 4°C (up to one week) is advised to preserve the integrity of the remaining stock.

Gene Information and Variants

The gene encoding UPF0721 transmembrane protein yfcA and its related information are summarized in Table 3, highlighting the variant forms that have been characterized.

Table 3: Gene Information for yfcA Variants

ParameterInformation (Variant 1)Information (Variant 2)
Gene NameyfcAyfcA
SynonymsyfcA; b2327; JW2324; Probable membrane transporter protein YfcAyfcA; c2873; Probable membrane transporter protein YfcA
UniProt IDP0AD30P0AD31

The presence of different UniProt IDs (P0AD30 and P0AD31) indicates variant forms of the protein . These variants may derive from different strains of E. coli or represent isoforms with slight differences in sequence that may affect functional properties. Despite these potential variations, both forms are classified as probable membrane transporter proteins, suggesting conservation of their core functional role.

Potential Applications in Research

While the available information does not provide specific experimental data on the function or applications of recombinant yfcA protein, its classification as a membrane transporter protein suggests several potential research applications:

Antibody Production and Protein Detection

Purified recombinant proteins can serve as antigens for the production of specific antibodies, which can then be used for:

  1. Protein detection in Western blotting and immunoassays

  2. Immunolocalization studies to determine the cellular location of the native protein

  3. Functional studies using antibody-mediated blocking approaches

  4. Quantitative analysis of protein expression under various physiological conditions

The His-tagged recombinant yfcA protein is particularly well-suited for these applications due to its high purity and the availability of well-characterized anti-His antibodies that can be used for detection during method development.

Drug Discovery and Development

Membrane transporters represent important targets for drug discovery, as they mediate the uptake and efflux of many therapeutic compounds. Recombinant yfcA could potentially be utilized in:

  1. High-throughput screening of compound libraries to identify inhibitors or modulators

  2. Structure-based drug design if the protein structure is determined

  3. Studies exploring bacterial membrane transporters as potential targets for novel antibiotics

  4. Investigation of transport mechanisms that contribute to antibiotic resistance

Similar approaches have been successfully applied to other bacterial membrane proteins, leading to the identification of compounds that specifically inhibit transport functions essential for bacterial survival.

Current Limitations and Future Research Directions

Based on the available information, several limitations and potential directions for future research can be identified:

Knowledge Gaps

  1. The specific transport function and substrate specificity of yfcA remain to be determined

  2. Detailed structural information, such as the number and arrangement of transmembrane domains, is not available

  3. The physiological role of yfcA in E. coli biology is not well-characterized

  4. Regulatory mechanisms controlling yfcA expression under different environmental conditions are unknown

Future Research Directions

Future studies that would advance our understanding of yfcA could include:

  1. Functional characterization through transport assays with various potential substrates

  2. Structural studies using advanced techniques to resolve the three-dimensional architecture

  3. Gene knockout or silencing experiments to determine the physiological significance of yfcA in E. coli

  4. Comparative genomics to identify homologs in other bacterial species and infer evolutionary conservation of function

  5. Exploration of potential interactions with other membrane components or cytoplasmic partners

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yfcA; Z3590; ECs3211; Probable membrane transporter protein YfcA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yfcA
Target Protein Sequence
METFNSLFMVSPLLLGVLFFVAMLAGFIDSIAGGGGLLTIPALMAAGMSPANALATNKLQ ACGGSISATIYFIRRKVVSLSDQKLNIAMTFVGSMSGALLVQYVQADVLRQILPILVICI GLYFLLMPKLGEEDRQRRMYGLPFALIAGGCVGFYDGFFGPAAGSFYALAFVTLCGFNLA KATAHAKLLNATSNIGGLLLFILGGKVIWATGFVMLVGQFLGARMGSRLVLSKGQKLIRP MIVIVSAVMSAKLLYDSHGQEILHWLGMN
Uniprot No.

Target Background

Database Links

KEGG: ece:Z3590

STRING: 155864.Z3590

Protein Families
4-toluene sulfonate uptake permease (TSUP) (TC 2.A.102) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant yfcA production?

E. coli expression systems have been successfully employed for the recombinant production of yfcA protein. As demonstrated in commercial preparations, the protein can be expressed with various fusion tags to facilitate purification and detection . For research purposes, the following expression approaches are recommended:

  • Homologous expression in E. coli strains (BL21, Rosetta, C41/C43) optimized for membrane protein production

  • Use of mild inducible promoters (such as arabinose-inducible pBAD) to prevent toxicity during overexpression

  • Introduction of N-terminal or C-terminal affinity tags (His, GST, MBP) for purification purposes

When expressing membrane proteins like yfcA, lower induction temperatures (16-25°C) and extended expression times can improve proper folding and membrane integration .

What are the optimal storage and handling conditions for recombinant yfcA?

Recombinant yfcA requires specific storage and handling conditions to maintain stability and functionality. Based on established protocols for this protein, researchers should follow these guidelines:

  • For long-term storage, maintain the protein at -20°C to -80°C, preferably in aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Use storage buffers containing Tris/PBS with stabilizing agents such as glycerol (recommended at 5-50% final concentration) or trehalose (6%)

  • Prior to experimental use, briefly centrifuge vials to ensure all content is at the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

Researchers should note that repeated freeze-thaw cycles significantly reduce protein stability and functionality, so appropriate aliquoting upon initial reconstitution is crucial .

What purification methods are suitable for recombinant yfcA?

Since yfcA is a transmembrane protein, specialized purification methods are required to maintain its native structure. For His-tagged versions of recombinant yfcA, the following purification workflow is recommended:

  • Cell lysis using mild detergents (n-dodecyl-β-D-maltoside or digitonin) that preserve membrane protein structure

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins for His-tagged protein

  • Size exclusion chromatography to remove aggregates and improve sample homogeneity

  • Detergent exchange or reconstitution into lipid nanodiscs or proteoliposomes for functional studies

The final purified protein should achieve >90% purity as determined by SDS-PAGE analysis , with care taken to maintain the protein in detergent micelles throughout the purification process to prevent aggregation.

What quality control methods should be used to assess recombinant yfcA integrity?

Multiple analytical techniques should be employed to verify the quality of purified recombinant yfcA:

  • SDS-PAGE analysis to confirm protein size and purity (>90% recommended)

  • Western blotting with anti-His antibodies (for His-tagged variants) to confirm identity

  • Circular dichroism spectroscopy to assess secondary structure content (expected high α-helical content)

  • Size exclusion chromatography to evaluate monodispersity and absence of aggregation

  • Mass spectrometry to confirm molecular weight and post-translational modifications

Researchers should also consider functional assays specific to membrane transporters to verify that the protein maintains its native conformation and activity after purification.

What methodologies are most effective for functional characterization of yfcA transport properties?

As yfcA is classified as a probable membrane transporter protein , several complementary approaches can be employed to characterize its transport function:

  • Liposome reconstitution assays: Purified yfcA can be reconstituted into liposomes with fluorescent dyes or radiolabeled substrates to monitor transport activities. This system allows for controlled investigation of substrate specificity, kinetics, and inhibitor sensitivity.

  • Electrophysiological techniques: Patch clamp or planar lipid bilayer recordings can detect ion currents if yfcA functions as an ion channel or electrogenic transporter.

  • Transport assays in whole cells: Expression of yfcA in transport-deficient bacterial strains can be used to assess complementation of specific transport functions.

  • Substrate binding assays: Techniques such as microscale thermophoresis (MST) or isothermal titration calorimetry (ITC) can determine binding affinities for potential substrates.

For all functional studies, researchers should consider using both wild-type protein and targeted mutants to identify key residues involved in transport mechanisms.

How can researchers design effective mutagenesis studies to identify functional domains in yfcA?

Strategic mutagenesis approaches for yfcA structural-functional studies should include:

  • Alanine scanning mutagenesis of conserved residues in predicted transmembrane domains and loop regions

  • Site-directed mutagenesis targeting:

    • Charged residues (particularly in transmembrane regions)

    • Conserved motifs identified through sequence alignment

    • Residues predicted to line substrate binding pockets or translocation pathways

  • Construction of chimeric proteins by swapping domains with related transporters to identify regions responsible for substrate specificity

  • Cysteine substitution accessibility method (SCAM) to map solvent-accessible residues in transmembrane domains

The amino acid sequence of yfcA reveals several regions with high conservation that would be primary targets for mutagenesis, including the hydrophobic transmembrane segments and charged residues that may participate in substrate recognition or energy coupling .

What approaches can be used to determine the three-dimensional structure of yfcA?

Determining the structure of membrane proteins like yfcA presents significant challenges. Researchers should consider these methodologies:

  • X-ray crystallography:

    • Use of fusion partners (e.g., T4 lysozyme) to increase polar surface area

    • Screening multiple detergents to identify optimal crystallization conditions

    • Antibody fragment co-crystallization to stabilize flexible regions

  • Cryo-electron microscopy (cryo-EM):

    • Sample preparation in nanodiscs or amphipols

    • Use of Volta phase plates to enhance contrast

    • Single-particle analysis for structural determination

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR with detergent-solubilized protein for dynamic studies

    • Solid-state NMR for proteins reconstituted in lipid bilayers

  • Computational modeling:

    • Homology modeling based on related transporters

    • Molecular dynamics simulations to study conformational changes

Each approach has advantages and limitations, and often a combination of techniques provides the most complete structural characterization.

How can researchers investigate protein-protein interactions involving yfcA?

To identify potential interaction partners and characterize protein-protein interactions of yfcA, researchers can employ these techniques:

  • Co-immunoprecipitation (Co-IP) using tagged yfcA to pull down interaction partners from native membrane preparations

  • Bacterial two-hybrid or MYTH (membrane yeast two-hybrid) systems specifically designed for membrane protein interactions

  • Proximity labeling techniques such as BioID or APEX2 fusion proteins to identify proteins in the vicinity of yfcA in vivo

  • Cross-linking mass spectrometry (XL-MS) to capture transient interactions and map interaction interfaces

  • Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to visualize interactions in living cells

When investigating membrane protein interactions, it's crucial to use mild solubilization conditions that preserve native membrane environments and protein complexes.

What experimental designs can effectively evaluate the physiological role of yfcA in E. coli?

To determine the biological significance of yfcA in E. coli, researchers should consider these experimental approaches:

  • Gene knockout/knockdown studies:

    • Creation of yfcA deletion strains

    • Phenotypic characterization under various growth conditions

    • Complementation with wild-type and mutant variants

  • Transcriptomic and proteomic profiling:

    • RNA-Seq or microarray analysis to identify genes co-regulated with yfcA

    • Comparative proteomics of wild-type and yfcA mutant strains

  • Metabolomic analyses:

    • Targeted metabolite profiling to identify accumulation or depletion of potential substrates

    • Isotope labeling to track metabolic fluxes

  • High-throughput phenotypic screening:

    • Growth under different stress conditions

    • Sensitivity to various antibiotics or toxic compounds

    • Biofilm formation and other physiological parameters

  • In vivo localization studies:

    • Fluorescent protein fusions to track subcellular localization

    • Co-localization with other membrane proteins or cellular structures

These approaches should be designed with appropriate controls and statistical analyses to ensure robust interpretation of results.

What are the challenges and solutions in maintaining protein stability during experiments with yfcA?

Transmembrane proteins like yfcA present unique stability challenges. Researchers should implement these strategies:

  • Detergent optimization:

    • Screen multiple detergent types (maltosides, glucosides, neopentyl glycols)

    • Consider detergent mixtures for enhanced stability

    • Use lipid supplementation to mimic native membrane environment

  • Buffer optimization:

    • Include glycerol (5-50%) or trehalose (6%) as stabilizing agents

    • Maintain appropriate pH (typically 7.0-8.0)

    • Add reducing agents to prevent oxidation of cysteine residues

  • Temperature considerations:

    • Conduct experiments at lower temperatures when possible

    • Avoid freeze-thaw cycles by proper aliquoting

    • Store working solutions at 4°C for short-term use (≤1 week)

  • Alternative stabilization approaches:

    • Nanodiscs or SMALPs (styrene-maleic acid lipid particles) to maintain lipid environment

    • Thermostabilizing mutations for structural studies

    • Antibody fragments or nanobodies as stabilizing binding partners

Monitoring protein stability throughout experiments using techniques like dynamic light scattering or size exclusion chromatography is recommended to ensure data quality.

How should researchers address potential experimental artifacts in functional studies of yfcA?

Membrane protein research is prone to several artifacts that must be controlled for:

  • Expression-related artifacts:

    • Protein misfolding or aggregation due to overexpression

    • Toxicity effects on host cells

    • Incomplete membrane insertion

  • Purification-related artifacts:

    • Detergent effects on protein function

    • Co-purifying contaminants affecting activity

    • Loss of essential lipids or cofactors

  • Reconstitution-related artifacts:

    • Random vs. oriented protein insertion into liposomes

    • Leaky liposomes causing false-positive results

    • Detergent remnants affecting membrane integrity

  • Analytical controls:

    • Include protein-free/empty vector controls

    • Use catalytically inactive mutants as negative controls

    • Perform parallel assays with well-characterized related transporters

Proper experimental design with appropriate controls can help distinguish genuine physiological functions from artifacts.

What statistical approaches are appropriate for analyzing yfcA functional data?

Robust statistical analysis is essential for interpreting functional data from yfcA studies:

  • For kinetic measurements:

    • Non-linear regression analysis for transport kinetics (Michaelis-Menten, Hill equations)

    • Global fitting of multiple datasets to constrain parameters

    • Bootstrap or Monte Carlo methods to estimate parameter uncertainty

  • For comparative studies:

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Mixed-effects models for experiments with nested factors

    • Statistical power analysis to determine appropriate sample sizes

  • For high-throughput assays:

    • Multiple testing correction (Bonferroni, FDR) to control false discoveries

    • Multivariate analysis to identify patterns across conditions

    • Machine learning approaches for complex datasets

  • For structural data:

    • Appropriate validation metrics (R-factors, resolution, model geometry)

    • Ensemble analysis for NMR or computational models

    • Statistical assessment of conformational populations

Researchers should clearly report statistical methods, sample sizes, and significance levels in publications to ensure reproducibility.

How can advanced imaging techniques contribute to understanding yfcA function?

Cutting-edge imaging approaches offer new insights into yfcA dynamics and localization:

  • Super-resolution microscopy (PALM, STORM, STED) to visualize yfcA distribution patterns beyond the diffraction limit

  • Single-molecule tracking to monitor yfcA mobility and interactions in native membranes

  • Correlative light and electron microscopy (CLEM) to connect functional observations with ultrastructural context

  • Cryo-electron tomography of whole cells to visualize yfcA in its native membrane environment

  • Live-cell imaging with fluorescent sensors to correlate yfcA activity with substrate gradients or metabolic states

These techniques can reveal functional aspects of yfcA that are inaccessible through conventional biochemical assays alone.

What computational approaches can enhance experimental studies of yfcA?

Integrating computational methods with experimental work provides deeper insights:

  • Molecular dynamics simulations to model:

    • Conformational changes during transport cycles

    • Interactions with lipids and potential substrates

    • Effects of mutations on protein dynamics

  • Machine learning approaches for:

    • Predicting substrate specificity from sequence

    • Identifying functional residues from evolutionary data

    • Optimizing experimental conditions

  • Systems biology modeling to:

    • Place yfcA function in broader metabolic context

    • Predict phenotypic consequences of yfcA perturbation

    • Identify potential compensatory mechanisms

  • Quantum mechanics/molecular mechanics (QM/MM) calculations for:

    • Modeling transition states in transport mechanisms

    • Understanding energetics of substrate binding

Computational predictions should guide experimental design in an iterative process to accelerate research progress.

What are the most promising research directions for advancing understanding of yfcA?

Based on current knowledge and methodological capabilities, these research priorities are recommended:

  • Definitive substrate identification through systematic transport assays and binding studies

  • High-resolution structural determination using cryo-EM or X-ray crystallography to reveal the molecular basis of transport

  • In vivo functional characterization to establish the physiological role within bacterial metabolism and potential relevance to antimicrobial development

  • Comparative studies across bacterial species to understand evolutionary conservation and specialization of function

  • Integration with systems-level approaches to position yfcA within broader cellular networks and stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.