Recombinant UPF0749 protein Mb1854 (Mb1854)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its use in production.
Synonyms
BQ2027_MB1854; UPF0749 protein Mb1854
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-307
Protein Length
Full Length of Mature Protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1854
Target Protein Sequence
QPQRIPVPSLLRALLSEHLDAGYAAVAAERERAAAPRCWQARAVSWMWQALAATLVAAVF AAAVAQARSVAPGVRAAQQLLVASVRSTQAAATTLAQRRSTLSAKVDDVRRIVLADDAEG QRLLARLDVLSLAAASAPVVGPGLTVTVTDPGASPNLSDVSKQRVSGSQQIILDRDLQLV VNSLWESGAEAISIDGVRIGPNVTIRQAGGAILVDNNPTSSPYTILAVGPPHAMQDVFDR SAGLYRLRLLETSYGVGVSVNVGDGLALPAGATRDVKFAKQIGP
Uniprot No.

Target Background

Protein Families
UPF0749 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0749 protein Mb1854 and what organism does it originate from?

UPF0749 protein Mb1854 is an uncharacterized protein from Mycobacterium bovis, a bacterium closely related to Mycobacterium tuberculosis. The "UPF" designation (Uncharacterized Protein Family) indicates that its specific biological function remains to be fully elucidated. The recombinant form is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and downstream applications .

How does the recombinant Mb1854 protein differ from its native form?

The recombinant Mb1854 protein is produced with an N-terminal His-tag, which facilitates purification using metal affinity chromatography. This tag may slightly alter the protein's properties compared to its native form, including molecular weight, solubility, and potentially certain interaction surfaces. Additionally, the recombinant protein is expressed in E. coli rather than its native Mycobacterium bovis environment, which may result in differences in post-translational modifications that could affect function and activity .

What are the optimal storage conditions for maintaining Mb1854 stability?

For long-term storage, recombinant Mb1854 should be stored at -20°C to -80°C in aliquots to avoid repeated freeze-thaw cycles. The lyophilized powder formulation provides stability during storage. Working aliquots can be maintained at 4°C for up to one week. The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which enhances stability. For extended preservation, addition of 5-50% glycerol (with 50% being optimal) before aliquoting is recommended .

What is the recommended reconstitution protocol for lyophilized Mb1854?

For optimal reconstitution of lyophilized Mb1854:

  • Briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

This protocol minimizes protein degradation and maintains functionality for downstream applications .

How can researchers verify the purity and integrity of Mb1854 protein preparations?

Multiple analytical methods should be employed to assess protein quality:

  • SDS-PAGE analysis to confirm >90% purity and expected molecular weight

  • Western blotting using anti-His antibodies to verify the presence of the His-tag

  • Mass spectrometry for precise molecular weight determination and sequence verification

  • Size exclusion chromatography to assess aggregation state and homogeneity

  • Dynamic light scattering to evaluate protein monodispersity

  • Circular dichroism spectroscopy to analyze secondary structure integrity

These complementary approaches provide comprehensive validation of protein preparation quality before experimental use .

What experimental approaches can be used to investigate Mb1854's potential biological functions?

Since Mb1854 is an uncharacterized protein, multiple experimental strategies should be employed:

  • Bioinformatic analysis: Sequence comparison with characterized proteins and identification of conserved domains using tools like BLAST, Pfam, and SMART

  • Protein-protein interaction studies: Yeast two-hybrid screening, co-immunoprecipitation, or pull-down assays to identify binding partners

  • Structural determination: X-ray crystallography, NMR spectroscopy, or cryo-EM to reveal structural features

  • Gene knockout/knockdown studies: CRISPR-Cas9 or antisense RNA approaches in mycobacterial species to observe phenotypic changes

  • Expression profiling: Analysis of gene expression under various conditions to identify potential functional contexts

  • Biochemical assays: Testing for enzymatic activities based on structural predictions

These approaches can provide converging evidence regarding the protein's function in mycobacterial biology .

How can Mb1854 be used in mycobacterial pathogenesis research?

Mb1854 can be utilized in pathogenesis research through several methodological approaches:

  • Comparative expression analysis: Examining Mb1854 expression levels during different stages of infection

  • Antigenicity studies: Investigating whether Mb1854 elicits immune responses in host organisms

  • Virulence correlation: Comparing Mb1854 sequence and expression between virulent and avirulent Mycobacterium strains

  • Host-pathogen interaction assays: Using the recombinant protein to identify potential host targets

  • Structural vaccine design: Utilizing structural information for epitope mapping and immunogen development

  • Drug target assessment: Evaluating Mb1854 as a potential novel drug target through binding assays and inhibitor screening

These applications contribute to understanding mycobacterial infection mechanisms and potential therapeutic approaches .

What are the main challenges in studying uncharacterized proteins like Mb1854?

Research on uncharacterized proteins like Mb1854 faces several methodological challenges:

  • Functional prediction limitations: Lack of characterized homologs makes function prediction difficult

  • Expression and purification optimization: Determining conditions that maintain native folding and activity

  • Assay design uncertainty: Without functional insights, selecting appropriate activity assays is challenging

  • Structural determination barriers: Crystallization difficulties or dynamic regions complicating structural studies

  • Biological context identification: Determining relevant conditions for functional studies

  • Validation challenges: Confirming putative functions in the absence of established assays

Addressing these challenges requires iterative experimental designs and integrating multiple lines of evidence from diverse biochemical and biophysical approaches .

How does Mb1854 compare to its homologs in related mycobacterial species?

Comparative analysis reveals that Mb1854 has a close homolog in Mycobacterium tuberculosis, the UPF0749 protein Rv1823/MT1871. Both proteins share identical amino acid sequences (amino acids 24-307), suggesting conserved functions across these pathogenic mycobacterial species. This conservation indicates potential biological significance in mycobacterial physiology or pathogenesis. Comparative genomic and proteomic studies across additional mycobacterial species could reveal evolutionary patterns and functional constraints that would provide insights into the protein's biological role .

What advanced analytical techniques would be most informative for elucidating Mb1854's structure-function relationships?

A multi-faceted structural biology approach would be most informative:

  • High-resolution structural determination: X-ray crystallography at <2.0Å resolution or cryo-EM

  • NMR spectroscopy: For studying dynamics and ligand interactions in solution

  • Hydrogen-deuterium exchange mass spectrometry: To identify flexible regions and potential binding interfaces

  • Molecular dynamics simulations: To model protein flexibility and potential conformational changes

  • Cross-linking mass spectrometry: To capture transient protein-protein interactions

  • SAXS/SANS: For analyzing solution structure and conformational ensembles

  • Site-directed mutagenesis coupled with functional assays: To validate the importance of specific residues

This integrated approach would elucidate both structural features and their functional significance .

How might Mb1854 be involved in mycobacterial stress response or virulence mechanisms?

Several experimental approaches can test hypotheses about Mb1854's role in stress response or virulence:

  • Expression profiling: Quantifying Mb1854 expression under various stress conditions (oxidative stress, nutrient limitation, pH changes, antibiotic exposure)

  • Phenotypic analysis of knockout strains: Evaluating survival rates of Mb1854-deficient mycobacteria under stress conditions

  • Intracellular survival assays: Comparing wild-type and Mb1854-deficient strains in macrophage infection models

  • Animal infection models: Assessing virulence attenuation in Mb1854 mutants

  • Transcriptomic and proteomic profiling: Identifying genes and proteins with expression patterns correlating with Mb1854

  • Metabolomic analysis: Detecting metabolic changes associated with Mb1854 expression or deletion

These approaches can reveal potential roles in stress adaptation or virulence, providing direction for targeted functional studies .

What are the implications of studying Mb1854 for potential therapeutic development against mycobacterial infections?

Investigating Mb1854 has several potential therapeutic implications:

  • Novel drug target identification: If Mb1854 proves essential for mycobacterial survival or virulence, it could represent a new therapeutic target

  • Structure-based drug design: High-resolution structural data could facilitate in silico screening and rational design of inhibitors

  • Vaccine development: If Mb1854 is immunogenic, it might serve as a component in subunit vaccines

  • Diagnostic applications: Mb1854-specific antibodies could be developed for diagnostic purposes

  • Drug resistance mechanisms: Understanding Mb1854's function might reveal new insights into antibiotic resistance mechanisms

  • Host-pathogen interactions: Identifying host proteins that interact with Mb1854 could reveal new therapeutic approaches targeting these interactions

These various applications underscore the importance of fundamental research on uncharacterized mycobacterial proteins like Mb1854 for developing next-generation anti-tuberculosis therapies .

How can researchers distinguish between the functional properties of Mb1854 and its closely related homologs?

Differentiating the functions of Mb1854 and its homologs requires systematic comparative approaches:

  • Complementation studies: Testing whether homologs can restore function in Mb1854 knockout strains

  • Domain swapping experiments: Creating chimeric proteins to identify functionally distinct regions

  • Comparative binding assays: Identifying differential interaction partners using techniques like BioID or APEX proximity labeling

  • Species-specific expression contexts: Analyzing expression patterns across different mycobacterial species and conditions

  • Cross-species phenotypic analysis: Comparing phenotypes of knockout strains across different mycobacterial species

  • Differential structural analysis: Identifying subtle structural differences that might impact function using high-resolution structural biology

These methods can reveal both shared and unique functional aspects of Mb1854 and its homologs, providing insights into mycobacterial evolution and adaptation .

What controls are essential when conducting experiments with recombinant Mb1854?

Rigorous experimental design requires several critical controls:

  • Negative controls:

    • Buffer-only conditions to assess baseline measurements

    • Irrelevant His-tagged proteins to control for tag-specific effects

    • Heat-denatured Mb1854 to distinguish between specific and non-specific effects

  • Positive controls:

    • Well-characterized proteins with known activities in relevant assays

    • Validated interaction partners if available

  • Technical controls:

    • Multiple protein preparations to ensure reproducibility

    • Concentration gradients to establish dose-dependency

    • Time-course experiments to determine optimal reaction times

These controls ensure experimental rigor and facilitate meaningful interpretation of results when working with an uncharacterized protein .

What are the recommended approaches for analyzing post-translational modifications of Mb1854?

A comprehensive analysis of post-translational modifications (PTMs) requires multiple complementary techniques:

  • Mass spectrometry-based approaches:

    • Bottom-up proteomics with enrichment strategies for specific PTMs

    • Top-down proteomics for intact protein analysis

    • Targeted MS/MS for specific modification sites

  • Biochemical methods:

    • Western blotting with modification-specific antibodies

    • Enzymatic treatments to remove specific modifications

    • Mobility shift assays to detect modifications altering electrophoretic behavior

  • Comparative analysis:

    • PTM patterns in native vs. recombinant proteins

    • PTM changes under different growth conditions

    • Cross-species comparison of modification sites

These approaches provide complementary information about the presence and functional significance of PTMs on Mb1854 .

How should researchers approach epitope mapping and antibody development for Mb1854?

A systematic epitope mapping and antibody development strategy includes:

  • Computational epitope prediction:

    • B-cell epitope prediction algorithms

    • Structural analysis to identify surface-exposed regions

    • Conservation analysis across homologs to identify unique regions

  • Experimental validation:

    • Peptide array screening with sera from infected or immunized animals

    • Hydrogen-deuterium exchange mass spectrometry to identify accessible regions

    • Phage display to identify high-affinity peptide mimotopes

  • Antibody development and validation:

    • Immunization with full-length protein and/or synthetic peptides

    • Screening for specificity using ELISA, Western blotting, and immunoprecipitation

    • Cross-reactivity testing against homologs from related species

    • Validation in native expression contexts using immunofluorescence or immunohistochemistry

This comprehensive approach enables development of well-characterized antibodies for Mb1854 detection and functional studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.