Recombinant UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489 (BA_4840, GBAA_4840, BAS4489)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BA_4840; GBAA_4840; BAS4489; UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
BA_4840
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.

Target Background

Database Links

KEGG: ban:BA_4840

STRING: 260799.BAS4489

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489?

UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489 is a transmembrane protein from Bacillus anthracis with 153 amino acids . The UPF0756 designation refers to an Uncharacterized Protein Family, indicating that while the protein has been identified and sequenced, its specific functional characteristics remain incompletely understood. This protein is encoded in the Bacillus anthracis genome and has been assigned the UniProt ID Q81KZ4 . The protein belongs to a family of membrane proteins with potentially conserved functions across related bacterial species.

What expression systems are recommended for producing this recombinant protein?

Based on available data, E. coli expression systems have been successfully employed to produce recombinant UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489 . The recombinant version is typically generated with an N-terminal His-tag to facilitate purification processes. Researchers should note that the protein has been successfully expressed as a full-length construct (1-153 amino acids) , suggesting that the complete protein can be produced without compromising structural integrity. This information provides a starting point for researchers seeking to generate the protein for experimental purposes.

What are the recommended storage conditions for this protein?

For optimal stability and activity preservation, the recombinant UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489 should be stored at -20°C/-80°C upon receipt . For laboratories conducting extended studies, aliquoting is necessary for multiple uses to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity. Working aliquots may be stored at 4°C for up to one week without significant degradation. The commercially available protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which enhances stability during storage .

How should the recombinant protein be reconstituted for experimental use?

The lyophilized recombinant UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489 should be briefly centrifuged before opening to ensure all material is collected at the bottom of the vial . Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage of reconstituted protein, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard concentration used by manufacturers . This glycerol addition prevents ice crystal formation during freezing, which can denature the protein structure.

What purification approaches are effective for this membrane protein?

Given that the recombinant UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489 is engineered with an N-terminal His-tag , immobilized metal affinity chromatography (IMAC) represents the primary purification method. This approach typically yields protein with greater than 90% purity as determined by SDS-PAGE analysis . For membrane proteins like UPF0756, purification protocols must include appropriate detergents to maintain solubility throughout the process. The purification strategy must balance the needs for high purity with maintaining the native structural characteristics of the protein.

What structural information is available for UPF0756 membrane proteins?

While specific structural data (X-ray crystallography or cryo-EM) for the BA_4840/GBAA_4840/BAS4489 protein is not explicitly provided in the available sources, sequence analysis suggests it contains multiple transmembrane domains characteristic of integral membrane proteins. The protein's relatively small size (153 amino acids) and its classification within the UPF0756 family indicate it likely adopts a compact membrane-spanning structure. Researchers investigating structural aspects would need to employ techniques such as circular dichroism spectroscopy to assess secondary structure content or more advanced methods like NMR or crystallography for detailed structural determination.

How does UPF0756 membrane protein compare to similar proteins in other organisms?

The UPF0756 membrane protein family includes related proteins across various bacterial species. For instance, the E. coli homolog is the UPF0756 membrane protein YeaL (P0ACY8) , which shares functional classification but has sequence variations reflecting species-specific adaptations. The YeaL protein consists of 148 amino acids compared to the 153 amino acids in the Bacillus anthracis version . These related proteins likely maintain conserved structural features while potentially exhibiting species-specific functional adaptations. Comparative analysis between these homologs can provide insights into evolutionary conservation and functional significance.

What methodological approaches can identify potential interaction partners?

To investigate the interaction network of UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489, researchers should consider implementing the following complementary approaches:

Table 1: Methodological Approaches for Membrane Protein Interaction Studies

MethodApplicationAdvantagesLimitations
Pull-down assaysDirect binding partnersCan use recombinant His-tagged protein as baitMay miss weak or transient interactions
Cross-linking MSSpatial proximityCaptures transient interactionsComplex data analysis
Bacterial two-hybridIn vivo interactionsDetects interactions in cellular contextPotential false positives
Co-immunoprecipitationEndogenous complexesIdentifies native interactionsRequires specific antibodies
Label transferProximity mappingIdentifies proteins in close proximityRequires optimization of labeling conditions

These approaches should be implemented with appropriate controls and validations to minimize false positives inherent in membrane protein interaction studies. The methodologies must account for the hydrophobic nature of membrane proteins and the challenges of maintaining native conformations during experimental procedures.

What functional assays can elucidate the biological role of this protein?

Given the uncharacterized nature of UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489, a systematic approach to functional characterization is essential:

  • Genetic Manipulation Studies: Employ gene knockout or knockdown approaches in Bacillus anthracis to observe resulting phenotypes. Complementation studies with wild-type or mutated versions can confirm specificity of observed effects.

  • Localization Studies: Use fluorescent protein fusions or immunolocalization to determine subcellular distribution, which may provide functional clues.

  • Comparative Genomics: Analyze genomic context across species to identify conserved gene neighborhoods that suggest functional relationships.

  • Transport Assays: If transmembrane transport function is suspected, reconstitute the protein in liposomes and assess movement of various substrates across the membrane.

  • Structural Studies: Implement circular dichroism, NMR spectroscopy, or X-ray crystallography to gain insights into structure-function relationships.

The challenge of working with uncharacterized membrane proteins requires a multifaceted approach that integrates various experimental methodologies to gradually build a functional profile.

How can site-directed mutagenesis be applied to study structure-function relationships?

Site-directed mutagenesis represents a powerful approach to investigating the functional significance of specific amino acid residues within UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489. A systematic mutagenesis strategy should include:

  • Conservation-Based Targeting: Identify highly conserved residues across UPF0756 family members, which often indicate functional importance. The comparison between BA_4840/GBAA_4840/BAS4489 and YeaL protein sequences can reveal such conserved regions.

  • Domain-Specific Mutations: Create mutations in predicted transmembrane regions versus loop regions to assess domain-specific functions.

  • Charged Residue Analysis: Charged amino acids within transmembrane regions often have crucial functional roles and should be prioritized for mutagenesis.

  • Alanine Scanning: Implement systematic alanine substitutions across the protein to identify regions critical for function without dramatically altering protein structure.

  • Function-Based Assessment: Each mutant should undergo assessment for expression, folding, localization, and activity using established functional assays.

This approach aligns with methodologies employed in membrane protein research, such as those described for ERAD (ER-associated degradation) studies of polytopic membrane proteins , where specific mutations help elucidate functional mechanisms.

What challenges exist in structural biology studies of this membrane protein?

Structural studies of UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489 face several significant challenges:

  • Protein Production: While E. coli expression systems have been successful , obtaining sufficient quantities of properly folded protein remains challenging.

  • Protein Stability: Maintaining stability during purification and subsequent structural studies requires optimization of detergent conditions. The recommended storage in Tris/PBS buffer with 6% Trehalose provides a starting point, but condition screening is essential.

  • Crystallization Barriers: As with many membrane proteins, crystallization is complicated by the presence of detergent micelles and the hydrophobic nature of the protein.

  • Size Considerations: At 153 amino acids , the protein may be challenging for certain structural determination methods but potentially suitable for NMR studies if sufficient quantities can be produced.

  • Functional Validation: Confirming that the protein retains native structure and function throughout the purification and structural analysis process adds an additional layer of complexity.

These challenges echo those faced in structural studies of other membrane proteins, requiring specialized approaches and often multiple complementary methods to achieve structural insights.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.