Recombinant UPF0761 membrane protein VP0125 (VP0125)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Role in Membrane Biogenesis:

  • VP0125 follows the Oxa1/SecY-mediated insertion model for alpha-helical membrane proteins, where short hydrophilic segments flank transmembrane domains (TMDs) .

  • Computational models suggest its TMDs interact with lipid bilayers via hydrophobic surfaces, necessitating detergent-free stabilization methods like de novo WRAP proteins for structural studies .

Enzymatic Association:

  • VP0125 is annotated as a ribonuclease BN (rbn) homolog in Vibrio species, implicating potential RNA-processing functions .

Research Applications

Diagnostic Tools:

  • Commercial ELISA kits utilize recombinant VP0125 for detecting V. parahaemolyticus antibodies .

Expression Systems Comparison:

Host SystemYieldPost-Translational Modifications
E. coliHighLimited
Insect cells (Baculovirus)ModerateGlycosylation possible
Mammalian cellsLowNative folding

Key Research Findings

  • Stability Optimization: Lyophilization with trehalose preserves activity for >12 months at -80°C .

  • Functional Retention: WRAP-solubilized VP0125 retains enzymatic activity, enabling in vitro screening for inhibitors .

  • Pathogenicity Studies: VP0125 is implicated in V. parahaemolyticus survival under osmotic stress, linked to its membrane integrity role .

Challenges and Future Directions

  • Aggregation Issues: Hydrophobic regions necessitate advanced solubilization strategies .

  • Vaccine Development: Preclinical trials are exploring VP0125 as a candidate antigen for vibriosis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. For dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
VP0125; UPF0761 membrane protein VP0125
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Target Names
VP0125
Target Protein Sequence
MNQLSESYKARLSNLLPSCVAFFKYLLKRLTHDRVNVNAGYLAYITLLSIVPMLTVLLSI LSKFPVFANVGEVLQGYIIENFVPASGEAVHTALQEFVANTGKMSAVGGGFLFIAALMLI SNIDKNLNYIWRVKDKRRLVFSFSMYWMVLTLGPILVGASIAATSYVTSLQILENETLSG AFNLFLRWLPLLLSFFAFLGLYILVPNKKVHLAHGAVGAAVAAILFELSKKGFALYITQF PSYQLIYGALAAIPILFVWVYLCWMIVLLGAEVTAALGEQEHWSEDLDMIHSSAESQLAN EGSESSDSANSTSQ
Uniprot No.

Target Background

Database Links

KEGG: vpa:VP0125

STRING: 223926.VP0125

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0761 membrane protein VP0125?

UPF0761 membrane protein VP0125 is a 314-amino acid membrane protein from Vibrio parahaemolyticus Serotype O3:K6, classified in the UPF0761 protein family of uncharacterized function. The protein contains multiple predicted transmembrane domains and is characterized by its hydrophobic regions interspersed with hydrophilic segments. Based on computational predictions, the protein likely plays a role in membrane transport or signaling, though its specific biological function remains to be fully elucidated. As with many membrane proteins, research on VP0125 is challenging due to difficulties in expression, purification, and structural characterization .

How is recombinant UPF0761 membrane protein VP0125 typically expressed?

Recombinant UPF0761 membrane protein VP0125 is typically expressed in E. coli expression systems with an N-terminal histidine tag to facilitate purification. The full-length protein (amino acids 1-314) can be successfully expressed using standard bacterial expression vectors that incorporate strong promoters such as T7. Expression typically involves induction at lower temperatures (16-20°C) to minimize inclusion body formation and promote proper folding of membrane proteins. While E. coli is the predominant expression system, researchers working with complex membrane proteins may also consider alternative expression systems such as yeast or insect cells if bacterial expression yields poor results or misfolded protein .

What are the optimal storage conditions for purified recombinant VP0125?

For optimal storage of purified recombinant VP0125, the protein should be stored at -20°C to -80°C in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose as a stabilizer. Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and aggregation. For working aliquots, storage at 4°C is suitable for up to one week, though protein stability should be verified periodically. When preparing long-term storage samples, it is recommended to add glycerol to a final concentration of 30-50% before aliquoting and freezing. This glycerol concentration helps prevent ice crystal formation and maintains protein integrity during storage. Prior to any experimental use, centrifugation of the thawed protein is recommended to remove any potential aggregates .

How should researchers approach the reconstitution of lyophilized VP0125?

Reconstitution of lyophilized VP0125 requires careful attention to maintain protein integrity and functionality. The lyophilized protein should first be briefly centrifuged to bring all contents to the bottom of the vial. Researchers should reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, adding the water slowly while gently rotating the vial to ensure even dissolution. After initial reconstitution, the solution should be allowed to stand at room temperature for 10-15 minutes before gentle mixing. For long-term storage after reconstitution, glycerol should be added to a final concentration of 30-50%, followed by aliquoting to minimize freeze-thaw cycles. Each experiment should utilize freshly thawed aliquots whenever possible, and researchers should verify protein integrity via SDS-PAGE before proceeding with functional assays .

What purification strategies yield the highest purity for recombinant VP0125?

Purification of His-tagged recombinant VP0125 membrane protein typically follows a multi-step process designed to maintain protein integrity while achieving high purity. The initial step involves cell lysis under native conditions using mild detergents suitable for membrane proteins, such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG). Following lysis, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides the primary purification step, with carefully optimized imidazole concentrations in wash and elution buffers to minimize non-specific binding while maximizing recovery. Size exclusion chromatography (SEC) serves as an essential secondary purification step to separate oligomeric states and remove aggregates. The final product typically achieves greater than 90% purity as determined by SDS-PAGE. Throughout the purification process, maintaining a stable detergent concentration above the critical micelle concentration (CMC) is crucial to prevent protein aggregation .

How can researchers assess the proper folding of recombinant VP0125?

Assessing proper folding of recombinant VP0125 membrane protein requires a multi-faceted approach. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content, with properly folded VP0125 expected to show characteristic spectra indicating significant α-helical content typical of transmembrane domains. Intrinsic tryptophan fluorescence spectroscopy can reveal tertiary structure integrity, as tryptophan residues in correctly folded conformations will exhibit specific fluorescence properties. Additionally, researchers can employ limited proteolysis assays, as properly folded membrane proteins typically show resistance to proteolytic digestion in their transmembrane regions while exposing susceptible sites in solvent-accessible regions. Functional assays specific to the predicted role of VP0125 (such as binding assays or transport activity measurements) provide the most definitive evidence of proper folding. Finally, thermal stability assays using differential scanning fluorimetry can assess protein stability and help optimize buffer conditions .

What are the challenges of structural studies with VP0125 membrane protein?

Structural studies of VP0125 membrane protein face several significant challenges inherent to membrane proteins. The hydrophobic nature of transmembrane regions makes crystallization difficult, often requiring extensive screening of detergents, lipids, and crystallization conditions. Cryo-EM approaches, while promising for membrane proteins, require highly pure, homogeneous, and stable protein preparations. For NMR studies, isotopic labeling of VP0125 requires optimization of expression conditions in minimal media, potentially reducing yields. The predicted multiple transmembrane domains of VP0125 (based on its sequence) create additional challenges for maintaining native conformation during purification and structural analysis. Researchers must carefully select stabilizing detergents that maintain protein structure while allowing for structural techniques. Alternative approaches include using antibody fragments or nanobodies to stabilize specific conformations, or employing lipidic cubic phase (LCP) crystallization methods that better mimic the membrane environment .

How should researchers approach contradictory results in VP0125 studies?

When faced with contradictory results in VP0125 studies, researchers should implement a systematic troubleshooting approach. First, examine differences in experimental conditions, including expression systems, purification methods, buffer compositions, and membrane/detergent environments, as membrane proteins are particularly sensitive to these variables. Document lot-to-lot variation in recombinant protein preparations, as differences in purity or folding states can significantly impact results. For functional assays, verify that the protein maintains its native conformation under the assay conditions using biophysical techniques. Consider whether the His-tag might be influencing results differently across experiments, potentially necessitating tag removal. Utilize multiple orthogonal techniques to validate findings, especially when characterizing novel functions. When publishing seemingly contradictory results, transparently report all experimental conditions and consider conducting direct comparative studies with previous protocols to identify critical variables affecting outcomes .

What bioinformatics tools are most useful for predicting VP0125 structure and function?

For comprehensive bioinformatic analysis of VP0125, researchers should employ a combination of specialized tools. Transmembrane domain prediction programs such as TMHMM, Phobius, and MEMSAT are essential for identifying potential membrane-spanning regions in the 314-amino acid sequence. For evolutionary analysis, tools like HMMER can identify distant homologs that might provide functional insights, while ConSurf can map conservation patterns onto predicted structures to identify functionally important residues. Structure prediction has advanced significantly with AlphaFold2, which can generate reasonably accurate models even for membrane proteins like VP0125. These predictions should be validated against hydropathy plots and transmembrane predictions. For functional prediction, researchers should use InterProScan to identify conserved domains, CATH/SCOP for structural classification if templates exist, and STRING for potential protein-protein interactions. Molecular dynamics simulations using GROMACS or NAMD with specialized membrane force fields can further refine structural models and predict dynamic behaviors in a lipid bilayer environment .

What is the predicted membrane topology of VP0125 based on sequence analysis?

Based on sequence analysis of the 314-amino acid VP0125 protein, bioinformatic predictions suggest a complex membrane topology with multiple transmembrane domains. Hydropathy analysis of the amino acid sequence indicates approximately 7-8 potential transmembrane helices, consistent with its classification as an integral membrane protein. The protein appears to have a cytoplasmic N-terminus, followed by alternating transmembrane segments and loop regions of varying sizes. Particularly notable is the relatively large cytoplasmic loop between predicted transmembrane helices 4 and 5, which may play a role in protein-protein interactions or signal transduction. The C-terminal region (amino acids ~280-314) is predicted to be cytoplasmic and contains several potential phosphorylation sites, suggesting possible regulatory functions. This topology model provides a foundation for experimental design, though researchers should validate these predictions through experimental approaches such as cysteine scanning mutagenesis, protease protection assays, or epitope tagging at predicted extramembrane regions .

How does VP0125 compare to other UPF0761 family proteins across bacterial species?

The UPF0761 family of membrane proteins, to which VP0125 belongs, is distributed across various bacterial species with notable sequence conservation in key regions. Comparative analysis reveals that VP0125 from Vibrio parahaemolyticus shares approximately 65-85% sequence identity with homologs in other Vibrio species, while dropping to 30-45% identity with more distant bacterial genera. Multiple sequence alignment shows highest conservation in the predicted transmembrane domains and certain connecting loops, suggesting functional importance of these regions. The protein family maintains a consistent pattern of hydrophobic residues corresponding to membrane-spanning segments across species. Notable variations occur primarily in the cytoplasmic loops and C-terminal region, potentially reflecting species-specific regulatory mechanisms or interaction partners. This evolutionary conservation pattern provides valuable insights for researchers identifying functionally critical residues for site-directed mutagenesis studies. The widespread distribution of UPF0761 family proteins across pathogenic and non-pathogenic bacteria suggests a fundamental cellular function rather than a virulence-specific role .

What experimental approaches can determine the subcellular localization of VP0125?

Determining the precise subcellular localization of VP0125 requires multiple complementary experimental approaches. Researchers should consider fractionation studies using differential centrifugation to separate bacterial membrane components, followed by Western blot analysis using anti-His antibodies or custom antibodies against VP0125. Immunofluorescence microscopy with specific antibodies can visualize the distribution pattern within bacterial cells, though this requires careful fixation protocols to preserve membrane structures. For higher resolution, immuno-electron microscopy can pinpoint the exact membrane systems where VP0125 resides. Fluorescent protein fusions (such as GFP-VP0125) can enable live-cell imaging, though care must be taken to ensure the fusion doesn't disrupt localization signals. Protease accessibility assays can determine the orientation of the protein within the membrane by selectively digesting exposed regions. APEX2 proximity labeling, where VP0125 is fused to an engineered peroxidase, can identify neighboring proteins and help confirm localization through the identification of known markers of specific membrane compartments .

What are the recommended protocols for reconstituting VP0125 in model membrane systems?

Reconstitution of VP0125 into model membrane systems requires careful optimization to maintain protein structure and function. Researchers should begin with detergent-purified VP0125 at >90% purity, then select an appropriate model system based on experimental goals. For functional studies, proteoliposomes offer a controlled environment: mix purified VP0125 with lipids (typically E. coli polar lipids or defined mixtures including POPC/POPE) at protein:lipid ratios between 1:100 and 1:1000 (w/w). Detergent removal can be achieved via dialysis, using Bio-Beads, or through dilution below the detergent's CMC. For structural studies, reconstitution into nanodiscs provides a more defined system: combine VP0125, appropriate membrane scaffold proteins (MSPs), and lipids at optimized ratios, followed by detergent removal. Bicelles represent an intermediate approach, using mixtures of long-chain and short-chain lipids or detergents. For all reconstitution methods, researchers should verify successful incorporation through techniques such as freeze-fracture electron microscopy, dynamic light scattering, or functional assays appropriate to the predicted activity of VP0125 .

How can VP0125 research contribute to understanding Vibrio parahaemolyticus pathogenesis?

Research on UPF0761 membrane protein VP0125 offers valuable insights into Vibrio parahaemolyticus biology and potential pathogenesis mechanisms. As an integral membrane protein with predicted transport or signaling functions, VP0125 may play roles in bacterial adaptation to host environments or environmental stress responses. Comparative genomic analyses show VP0125 is conserved across pathogenic Vibrio strains, suggesting functional importance. Researchers should investigate potential roles in virulence through targeted gene deletion studies, examining effects on adhesion, invasion, toxin secretion, or stress response. Protein-protein interaction studies may reveal associations with known virulence factors or regulatory networks. Additionally, researchers should examine VP0125 expression patterns under conditions mimicking host environments (varying pH, osmolarity, temperature) using qRT-PCR or reporter constructs. If structural data becomes available, researchers might identify potential inhibitor binding sites that could serve as targets for antimicrobial development. The contribution of membrane proteins like VP0125 to bacterial physiology represents an important but understudied aspect of Vibrio pathogenesis that merits further investigation .

What are the most promising techniques for studying VP0125 protein-protein interactions?

Investigating protein-protein interactions (PPIs) involving the membrane protein VP0125 requires specialized approaches. Affinity purification coupled with mass spectrometry (AP-MS) using His-tagged VP0125 as bait can identify interaction partners when performed under carefully optimized detergent conditions that preserve native interactions. Proximity-based labeling techniques such as BioID or APEX2, where VP0125 is fused to a biotin ligase or peroxidase, can identify proteins in close proximity within the native membrane environment, offering advantages for transient or weak interactions. Membrane yeast two-hybrid (MYTH) systems, specifically designed for membrane proteins, represent another valuable approach. For detailed interaction mapping, site-specific crosslinking using photo-activatable amino acid analogs incorporated at specific positions can pinpoint interaction interfaces. For validation, microscale thermophoresis (MST) or surface plasmon resonance (SPR) adapted for membrane proteins can quantify binding kinetics. Computational approaches including molecular docking should complement experimental methods, especially as structural information becomes available through cryo-EM or crystallography efforts .

What key research questions about VP0125 remain to be addressed?

Despite available information about the sequence and basic properties of VP0125, numerous critical research questions remain unanswered. Foremost is the determination of its precise biological function—whether it serves as a transporter, channel, receptor, or structural component—which requires comprehensive functional assays guided by bioinformatic predictions. The high-resolution structure of VP0125 remains unsolved, presenting an opportunity for breakthrough studies using cryo-EM or X-ray crystallography. The regulation of VP0125 expression under different environmental conditions and the stimuli that trigger its activity represent important unexplored areas. Researchers should investigate whether post-translational modifications affect VP0125 function, particularly given potential phosphorylation sites in the C-terminus. The identification of natural substrates or binding partners would significantly advance understanding of its cellular role. Additionally, the contribution of VP0125 to bacterial physiology, stress response, and potentially virulence needs systematic investigation through gene deletion studies and phenotypic analyses. These knowledge gaps present significant opportunities for researchers to make meaningful contributions to understanding this uncharacterized membrane protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.