Recombinant UPF0761 membrane protein VV1_0885 (VV1_0885)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
VV1_0885; UPF0761 membrane protein VV1_0885
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Vibrio vulnificus (strain CMCP6)
Target Names
VV1_0885
Target Protein Sequence
MNQLFGSDKLRLPQRAQAGIAFVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSI LSKFSVFENVGSVLQSFIINNFVPASGDAVHAALQEFIANTGKMTAVGAAFLFVAALMLI SNIDKNLNYIWRVKKKRRAVFSFSMYWMVLTLGPILVGASIAATSYITSLRLLDSEAIST VYDQLLRWLPFILSSSAFVGLYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQF PSYQLIYGALAAIPILFVWVYLCWLIVLIGAEVTAALGEREHWRPAEDVIQSLPNNDTEL EKDTQRDRFDSES
Uniprot No.

Target Background

Database Links

KEGG: vvu:VV1_0885

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0761 membrane protein VV1_0885 and what organism does it originate from?

UPF0761 membrane protein VV1_0885 is a recombinant protein derived from Vibrio vulnificus, a gram-negative bacterium often found in marine environments. The protein is classified as a membrane protein, suggesting its integration into cellular membranes. The protein is cataloged in UniProt under accession number Q8DDS2, providing standardized information about its structure and potential functions .

How should the recombinant UPF0761 membrane protein be stored for optimal stability?

For optimal stability, UPF0761 membrane protein VV1_0885 should be stored at -20°C in its provided storage buffer (Tris-based buffer with 50% glycerol). For extended storage periods, conservation at -20°C or -80°C is recommended. Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. For short-term work (up to one week), working aliquots can be stored at 4°C .

What are the recommended approaches for incorporating UPF0761 membrane protein into liposomes for functional studies?

For functional studies, researchers should consider a stepwise approach to reconstitution:

  • Prepare liposomes using phospholipids that mimic the native environment of Vibrio vulnificus membranes.

  • Solubilize the recombinant protein in a gentle detergent like n-dodecyl-β-D-maltoside (DDM).

  • Mix the detergent-solubilized protein with preformed liposomes.

  • Remove detergent gradually using adsorbent beads or dialysis.

  • Verify incorporation using techniques such as freeze-fracture electron microscopy or density gradient centrifugation.

This approach is comparable to methodologies used for other bacterial membrane proteins and should be optimized specifically for UPF0761 membrane protein's physicochemical properties.

How can researchers assess the functional integrity of UPF0761 membrane protein after purification?

Functional integrity assessment should employ multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy: To verify secondary structure integrity

  • Size Exclusion Chromatography (SEC): To confirm proper folding and oligomeric state

  • Intrinsic Fluorescence Measurements: To evaluate tertiary structure

  • Binding Assays: If ligands are known, verify binding capability using isothermal titration calorimetry

  • Functional Reconstitution: Incorporate into artificial membranes and assess specific functional parameters

Similar approaches have been successfully applied to other membrane proteins to verify structural integrity post-purification.

How does protein type influence the digestibility and absorption kinetics of recombinant proteins like UPF0761 membrane protein in biological systems?

Research on protein digestion and absorption kinetics, though not specific to UPF0761 membrane protein, provides valuable insights. Studies examining the impact of protein type on digestion and amino acid absorption have shown that different protein types (whey, casein, milk) have significantly different absorption kinetics. For instance, of dietary protein-derived phenylalanine, approximately 57% ± 10% from whey protein, 45% ± 11% from casein, and 65% ± 13% from milk protein appear in circulation over a 5-hour postprandial period .

While these findings aren't specific to membrane proteins like UPF0761, they suggest that protein structure and composition substantially influence digestibility and bioavailability—factors researchers should consider when designing experiments involving protein administration in biological systems.

Protein TypePercentage of Dietary Protein-Derived Phenylalanine in Circulation (5-hour period)
Casein45% ± 11%
Whey57% ± 10%
Milk65% ± 13%

What transcriptomic approaches are recommended for studying the expression of UPF0761 membrane protein under different environmental stressors?

Based on advanced transcriptomic methodologies used in similar research contexts, the following approach is recommended:

  • Experimental Design: Include multiple time points and biological replicates

  • RNA Extraction Protocol: Use specialized protocols for bacterial samples that maximize RNA integrity

  • Library Preparation: Employ strand-specific library preparation to capture antisense transcription

  • Sequencing Depth: Aim for at least 20 million reads per sample to ensure detection of low-abundance transcripts

  • Bioinformatic Analysis Pipeline:

    • Quality control using FastQC

    • Read alignment using HISAT2 or similar tool

    • Differential expression analysis using DESeq2 or edgeR

    • Pathway enrichment analysis to contextualize findings

This approach is informed by transcriptomic studies of bacterial responses to environmental stressors, such as those documented in Antarctic cyanobacteria research .

What computational methods are most effective for predicting the transmembrane domains of UPF0761 membrane protein?

For predicting transmembrane domains in UPF0761 membrane protein, a multi-tool consensus approach is recommended:

  • TMHMM: Provides baseline predictions with high specificity

  • Phobius: Accounts for signal peptides that might be confused with transmembrane domains

  • MEMSAT-SVM: Utilizes support vector machines for improved accuracy

  • TOPCONS: Generates consensus predictions from multiple algorithms

  • DeepTMHMM: Employs deep learning for enhanced prediction accuracy

Researchers should generate predictions using all tools and identify regions predicted as transmembrane domains by multiple methods. This consensus approach minimizes false positives and negatives, providing more reliable structural insights.

How can researchers determine the oligomeric state of UPF0761 membrane protein in its native environment?

Determining the oligomeric state of membrane proteins in their native environment requires multiple complementary techniques:

  • Blue Native PAGE: Separates protein complexes while maintaining native interactions

  • Chemical Cross-linking followed by MS/MS: Identifies interacting protein regions

  • Single-particle cryo-EM: Visualizes protein complexes in near-native conditions

  • FRET-based Approaches: For in vivo assessment of protein-protein interactions

  • Multi-angle Light Scattering: Determines absolute molecular mass

What are the common challenges in expressing recombinant membrane proteins like UPF0761 and how can they be addressed?

Common challenges in membrane protein expression include:

  • Protein Misfolding and Aggregation

    • Solution: Optimize expression temperature (typically lowering to 18-25°C)

    • Solution: Use specialized E. coli strains (C41, C43) designed for membrane protein expression

  • Low Expression Yields

    • Solution: Employ fusion tags (MBP, SUMO) to enhance solubility

    • Solution: Consider cell-free expression systems for difficult proteins

  • Toxicity to Host Cells

    • Solution: Use tightly regulated expression systems (e.g., pBAD)

    • Solution: Employ autoinduction media to gradually induce expression

  • Incorrect Membrane Insertion

    • Solution: Co-express with chaperones specific to membrane proteins

    • Solution: Consider homologous expression systems (e.g., Vibrio-based)

  • Purification Difficulties

    • Solution: Screen multiple detergents for optimal extraction

    • Solution: Use nanodisc or SMALPs for detergent-free purification

These solutions should be systematically tested and optimized for UPF0761 membrane protein.

How can researchers distinguish between proper protein folding and misfolding when working with UPF0761 membrane protein?

Distinguishing between properly folded and misfolded UPF0761 membrane protein requires a multi-parametric assessment:

  • Thermal Stability Assays: Properly folded proteins typically demonstrate cooperative unfolding transitions

  • Detergent Resistance: Well-folded membrane proteins resist precipitation upon detergent exchange

  • Limited Proteolysis: Properly folded proteins show distinct, limited digestion patterns

  • Tryptophan Fluorescence Spectroscopy: Measures tertiary structure through intrinsic fluorescence

  • Functional Assays: If function is known, activity tests provide the most relevant assessment of proper folding

Each technique provides different information about protein structure, so researchers should use multiple approaches for comprehensive evaluation.

How does UPF0761 membrane protein compare structurally and functionally to homologous proteins in other Vibrio species?

A comprehensive comparative analysis should include:

  • Sequence Alignment Analysis: Identify conserved domains and variable regions across Vibrio species

  • Phylogenetic Analysis: Establish evolutionary relationships among UPF0761 homologs

  • Structural Homology Modeling: Generate comparative models based on crystallized homologs

  • Conservation Mapping: Identify functionally important residues through evolutionary conservation

  • Expression Pattern Comparison: Analyze transcriptomic data to identify differential expression patterns

This comparative approach can provide insights into UPF0761's function by leveraging information from better-characterized homologs in related species.

What techniques are most effective for studying protein-lipid interactions of UPF0761 membrane protein?

For studying UPF0761 membrane protein-lipid interactions, the following techniques are recommended:

  • Molecular Dynamics Simulations: Provide atomistic insights into protein-lipid interactions

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Identifies protected regions in membrane environments

  • Solid-State NMR: Offers site-specific information about protein-lipid contacts

  • Native Mass Spectrometry: Can detect specifically bound lipids

  • Fluorescence-based Approaches: Including FRET and fluorescence quenching to monitor interactions

These methods provide complementary information, from broad interaction landscapes to specific binding sites, enabling comprehensive characterization of UPF0761's interaction with membrane lipids.

What statistical approaches are recommended for analyzing protein-protein interaction data involving UPF0761 membrane protein?

For robust analysis of protein-protein interaction data:

  • Data Preprocessing:

    • Apply appropriate normalization methods for the specific experimental technique

    • Use quality control metrics to identify and handle outliers

  • Statistical Testing:

    • For comparing interaction strengths: paired t-tests or Wilcoxon signed-rank tests

    • For multiple comparisons: apply FDR correction methods (e.g., Benjamini-Hochberg)

  • Network Analysis:

    • Calculate centrality measures to identify hub proteins

    • Perform clustering to identify functional modules

    • Apply Markov clustering for complex network partitioning

  • Validation Approaches:

    • Cross-validate findings using independent experimental methods

    • Implement bootstrapping to assess confidence in identified interactions

This multi-layered statistical approach minimizes both false positives and negatives in interaction studies.

How can researchers integrate transcriptomic and proteomic data to understand the regulation of UPF0761 membrane protein expression?

A comprehensive multi-omics integration approach for UPF0761 regulation should include:

  • Data Collection and Preprocessing:

    • Synchronize experimental conditions across omics platforms

    • Apply platform-specific normalization methods

    • Transform data to comparable scales

  • Correlation Analysis:

    • Calculate Pearson or Spearman correlations between transcript and protein levels

    • Identify discordant patterns suggesting post-transcriptional regulation

  • Pathway Enrichment:

    • Perform separate analyses for transcriptomics and proteomics

    • Compare enriched pathways to identify regulatory mechanisms

  • Network Integration:

    • Construct multi-layered networks incorporating both data types

    • Identify regulatory motifs and feedback mechanisms

  • Temporal Analysis:

    • If time-series data is available, analyze time lags between transcript and protein expression

    • Infer causal relationships using techniques like Granger causality

This integrated approach provides a systems-level understanding of UPF0761 regulation across biological layers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.