Recombinant UPF0761 membrane protein XOO3615 (XOO3615)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0761 Membrane Protein XOO3615

UPF0761 membrane protein XOO3615 is a bacterial protein derived from Xanthomonas oryzae pv. oryzae, a significant plant pathogen that causes bacterial blight in rice. The protein is classified as part of the UPF0761 family, with "UPF" designation indicating an uncharacterized protein family with conserved sequences across various bacterial species. This recombinant protein has been produced to facilitate research into bacterial membrane proteins and potentially to understand the pathogenicity mechanisms of Xanthomonas oryzae.

The protein is cataloged in the UniProt database with the accession number Q5GWQ2, providing standardized identification for research purposes. As a membrane protein, XOO3615 is embedded within the bacterial cell membrane, suggesting potential roles in cellular processes such as transport, signaling, or maintaining membrane integrity in the bacterial host organism.

Protein Properties

The recombinant version of XOO3615 exhibits several key physical and biochemical properties that are relevant for research applications. These properties are summarized in the following table:

PropertyDescription
Organism SourceXanthomonas oryzae pv. oryzae
UniProt IDQ5GWQ2
Protein Length425 amino acids (Full Length)
Molecular FunctionMembrane protein (specific function uncharacterized)
Physical FormLyophilized powder (recombinant)
PurityGreater than 90% as determined by SDS-PAGE

The recombinant protein's high purity level makes it suitable for a variety of research applications, including structural studies, functional assays, and the development of targeted inhibitors.

Recombinant Expression Systems

The recombinant UPF0761 membrane protein XOO3615 is produced using Escherichia coli as an expression system. This approach leverages E. coli's efficient protein synthesis machinery to generate substantial quantities of the target protein for research applications. The use of bacterial expression systems is particularly advantageous for producing bacterial proteins, as it often results in correct folding and post-translational modifications.

Protein Tags and Purification Strategies

The recombinant UPF0761 membrane protein XOO3615 is typically produced with an N-terminal histidine (His) tag. This modification involves adding a sequence of histidine residues to the N-terminus of the protein, which serves several important purposes:

  1. Facilitates purification through affinity chromatography using metal chelate resins

  2. Enables detection of the protein using anti-His antibodies

  3. May assist in solubility and stability of the recombinant protein

The addition of the His tag results in a fusion protein that maintains the functional domains of the native XOO3615 while providing technical advantages for laboratory handling and applications.

Reconstitution Protocol

The lyophilized recombinant protein requires proper reconstitution to ensure optimal activity for experimental applications. The recommended reconstitution protocol includes:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol to a final concentration of 5-50% (typically 50% is recommended)

  4. Aliquoting for long-term storage at -20°C to -80°C

This approach minimizes protein degradation while providing convenient working stocks for experimental use. The addition of glycerol prevents ice crystal formation during freezing, which can damage protein structure.

UPF0761 Protein Family Members

The UPF0761 family includes membrane proteins from various bacterial species. One notable related protein is the UPF0761 membrane protein Patl_3954 from Pseudoalteromonas atlantica. Comparing these proteins provides evolutionary and functional context for understanding XOO3615.

FeatureXOO3615 (Xanthomonas oryzae)Patl_3954 (Pseudoalteromonas atlantica)
UniProt IDQ5GWQ2Q15NT4
Length425 amino acids300 amino acids
Expression SystemE. coliE. coli
TagN-terminal HisN-terminal His
Organism TypePlant pathogen (rice)Marine bacterium

Despite belonging to the same protein family, these proteins differ significantly in length and originate from bacteria with different ecological niches, suggesting potential functional adaptations specific to their respective environments.

Current Research Applications

The recombinant UPF0761 membrane protein XOO3615 serves as a valuable tool for various research applications:

  1. Structural studies to elucidate the three-dimensional conformation using techniques such as X-ray crystallography or cryo-electron microscopy

  2. Functional assays to investigate potential roles in transport, signaling, or membrane integrity

  3. Development of antibodies for detection and localization studies

  4. Protein-protein interaction studies to identify binding partners

  5. Comparative analyses with homologous proteins from other bacterial species

As a purified recombinant protein, XOO3615 enables controlled in vitro studies that would be challenging with the native protein in its cellular context.

Computational Functional Prediction

Modern computational approaches represent powerful tools for predicting protein function from sequence data. Methods such as deep learning networks for protein functional inference, as described in the ProteInfer approach, could potentially provide insights into XOO3615 function by:

  1. Identifying structural similarities to proteins of known function

  2. Predicting functional domains and motifs

  3. Analyzing genomic context and co-expression patterns

  4. Mapping potential interaction networks

These computational predictions can generate testable hypotheses about the protein's biological role in Xanthomonas oryzae.

Future Research Directions

Understanding the structure and function of UPF0761 membrane protein XOO3615 presents several promising avenues for future research:

  1. Detailed structural determination using advanced biophysical techniques to elucidate the three-dimensional conformation

  2. Functional characterization through biochemical assays, mutagenesis studies, and in vivo experiments

  3. Investigation of potential roles in bacterial pathogenicity, particularly in the context of rice bacterial blight

  4. Development of targeted inhibitors that could have agricultural applications for controlling Xanthomonas infections

  5. Comparative functional studies with homologous proteins from other bacterial species

These research directions could significantly advance our understanding of this uncharacterized protein family and potentially reveal new targets for agricultural disease management strategies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
XOO3615; UPF0761 membrane protein XOO3615
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-425
Protein Length
full length protein
Species
Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Target Names
XOO3615
Target Protein Sequence
MSRVKKLHQWKERLRDRARTVSFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFG VLSAFPAFNEWKDALTDFIFTNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLIT LHSIEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQ WLAEFAWRLAPMAVEFICIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGVYLGN FQTYQRIYGALSALPILLLWIYLSWVSVLLGASLASSMAAFRYQPEAMRLPTGFEIYGLL RLLGRFRQARIHGEGLDEDRILALEPMLTDTLMQELLCELKRMRLLRRDERGQWLLARDL DLVPLAELYENCQLRVPIEDRPLPCRDDAYGQAAAAALEQLRQPLRSVLAQPVGDLYTHL PGDPP
Uniprot No.

Target Background

Database Links

KEGG: xoo:XOO3615

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0761 membrane protein XOO3615?

UPF0761 membrane protein XOO3615 is a membrane protein found in Xanthomonas oryzae pv. oryzae, a gram-negative bacterium that causes bacterial leaf blight in rice plants. The "UPF" designation indicates it belongs to an uncharacterized protein family (UPF0761), suggesting its function is not yet fully characterized. This protein is also referred to by the gene name "rbn" in some contexts and is sometimes labeled as a "hypothetical protein" . The protein is integral to the bacterial membrane and may play roles in essential cellular processes, though specific functions remain to be fully elucidated.

What expression systems are available for producing recombinant UPF0761 membrane protein XOO3615?

Recombinant UPF0761 membrane protein XOO3615 can be produced using various expression systems including cell-free expression systems and heterologous hosts such as E. coli, yeast, baculovirus, or mammalian cell systems . For membrane proteins, which can be challenging to express properly, the choice of expression system is critical. Cell-free expression systems offer advantages for initial studies as they can handle hydrophobic domains efficiently. For larger-scale production, E. coli or yeast systems may be preferable, while mammalian expression systems might be necessary if specific post-translational modifications are required for function . Each system presents distinct advantages and limitations that should be evaluated based on research objectives.

How should recombinant UPF0761 membrane protein XOO3615 be stored for maximum stability?

Recombinant UPF0761 membrane protein XOO3615 requires specific storage conditions to maintain stability and functionality. The protein is typically stored in a Tris-based buffer containing 50% glycerol, which helps prevent protein denaturation during freeze-thaw cycles . For short-term use (up to one week), the protein can be stored at 4°C. For longer-term storage, temperatures of -20°C or preferably -80°C are recommended . It's important to note that repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of activity. Researchers should prepare working aliquots to minimize freeze-thaw cycles and maintain protein integrity.

What optimal experimental designs can be employed to study the function of UPF0761 membrane protein XOO3615?

Studying the function of an uncharacterized membrane protein like UPF0761 membrane protein XOO3615 requires a comprehensive experimental design strategy. Optimal experimental designs allow parameters to be estimated without bias and with minimum variance, thereby reducing the costs of experimentation . A methodical approach would include:

  • Sequential Analysis Strategy:

    • Begin with bioinformatic analyses to generate hypotheses

    • Follow with iterative experimental validation

    • Implement adaptive designs that adjust based on preliminary findings

  • Response-Surface Methodology:

    • Systematically explore multiple variables affecting protein function

    • Utilize design strategies that require fewer experimental runs than traditional Box-Behnken designs

    • Employ optimal designs for quadratic models with discrete supports

  • Experimental Variables Matrix:

ParameterLevels to TestMeasurement Method
pH5.5, 6.5, 7.5, 8.5Activity assays
Temperature25°C, 30°C, 37°C, 42°CThermal stability
Ionic strength50mM, 100mM, 200mM, 300mMBinding affinity
LigandsControl, Candidate 1-3Interaction studies
  • Control Integration:

    • Include positive controls (well-characterized membrane proteins)

    • Incorporate negative controls (denatured protein, empty vector)

    • Design proper replication to account for experimental variance

This approach minimizes the number of experiments needed while maximizing information gained, creating an efficient path to functional characterization .

What strategies can be employed to identify potential interaction partners of UPF0761 membrane protein XOO3615?

Identifying interaction partners of membrane proteins like UPF0761 XOO3615 presents unique challenges requiring specialized approaches:

  • In Vivo Crosslinking Strategies:

    • Photo-crosslinking with genetically incorporated unnatural amino acids

    • Chemical crosslinking with membrane-permeable reagents

    • Analysis of crosslinked complexes by mass spectrometry

  • Proximity-Based Labeling Methods:

    • BioID: Fusion with promiscuous biotin ligase BirA*

    • APEX2: Fusion with engineered ascorbate peroxidase

    • TurboID: Enhanced biotin ligase for faster labeling

    • Quantitative analysis of labeled proteins by mass spectrometry

  • Membrane-Specific Yeast Two-Hybrid Systems:

    • Split-ubiquitin membrane yeast two-hybrid

    • MYTH (Membrane Yeast Two-Hybrid)

    • Careful design of bait constructs to maintain membrane topology

  • Co-Purification Approaches:

    • Optimization of detergent conditions to preserve interactions

    • Use of covalent crosslinking prior to solubilization

    • Application of gentle extraction methods like SMALPs

  • Validation Matrix:

MethodStrengthsLimitationsValidation Approach
CrosslinkingCaptures transient interactionsPotential artifactsReverse crosslinking
Proximity labelingWorks in native environmentNon-specific labelingDistance-dependent controls
Co-purificationDirect physical interactionDetergent interferenceReciprocal pulldowns
Genetic methodsFunctional relevanceIndirect interactionsPhenotypic validation

By employing multiple complementary approaches and validating findings through independent methods, researchers can build a high-confidence interaction network for UPF0761 membrane protein XOO3615.

How can I optimize solubilization and purification of UPF0761 membrane protein XOO3615 for structural studies?

Optimizing solubilization and purification of UPF0761 membrane protein XOO3615 for structural studies requires a systematic approach addressing the unique challenges of membrane proteins:

  • Detergent Screening Strategy:

    • Begin with mild detergents (DDM, LMNG) that maintain protein folding

    • Test detergent mixtures for improved extraction efficiency

    • Consider newer solubilization systems like nanodiscs, SMALPs, or amphipols

    • Monitor protein quality after solubilization by size-exclusion chromatography

  • Buffer Optimization Framework:

    • Implement optimal experimental design principles to efficiently test multiple variables

    • Create a factorial design testing pH, salt concentration, and additives simultaneously

    • Include stabilizing agents like glycerol or specific lipids

    • Use thermal stability assays to quantitatively assess buffer improvements

  • Purification Protocol Optimization:

    • Employ two-step or three-step purification strategies

    • Consider on-column detergent exchange during affinity purification

    • Optimize elution conditions to maintain protein stability

    • Use size exclusion chromatography as a final polishing step and quality control

  • Stability Assessment Techniques:

    • Differential scanning fluorimetry to assess thermal stability

    • Size exclusion chromatography to monitor monodispersity

    • Activity assays (if available) to confirm functional integrity

    • Limited proteolysis to identify stable domains

  • Applying EMC-Inspired Approaches:

    • Based on insights from the EMC (ER Membrane Protein Complex) architecture

    • Design purification strategies that preserve the native lipid environment

    • Consider the hydrophobic vestibule concept for stabilizing transmembrane domains

    • Evaluate lipid-protein interactions during purification

This methodical approach maximizes the likelihood of obtaining stable, homogeneous protein suitable for high-resolution structural studies while minimizing sample consumption.

What computational approaches can predict functional sites in UPF0761 membrane protein XOO3615?

Predicting functional sites in uncharacterized membrane proteins like UPF0761 XOO3615 requires sophisticated computational approaches:

  • Evolutionary Analysis Methods:

    • Multiple sequence alignment of UPF0761 family members

    • Calculation of conservation scores to identify highly conserved residues

    • Correlation-based methods to detect co-evolving residue networks

    • Evolutionary trace analysis to map conservation onto structural models

  • Structure-Based Prediction Tools:

    • Analysis of the AlphaFold-predicted structure of related UPF0761 proteins

    • Cavity detection algorithms to identify potential binding pockets

    • Electrostatic surface mapping to locate charged regions

    • Hydrophobicity analysis to identify potential substrate pathways

  • Machine Learning Approaches:

    • Trained neural networks for functional site prediction

    • Feature extraction from sequence and structural data

    • Integration of diverse data sources through ensemble methods

    • Confidence scoring for predictions based on model validation

  • Molecular Dynamics Simulations:

    • Identification of conformationally flexible regions

    • Water and ion accessibility analysis

    • Lipid interaction sites mapping

    • Binding site flexibility assessment

  • Integrative Prediction Framework:

Prediction MethodOutput DataValidation Approach
Conservation analysisConserved residue clustersComparison with related characterized proteins
Cavity detectionPotential binding pocketsLigand docking simulations
Electrostatic mappingCharged interaction sitesComparison with known membrane transport mechanisms
MD simulationsDynamic functional regionsCorrelation with predicted topology

These computational predictions should guide subsequent experimental verification through site-directed mutagenesis, providing a rational approach to functional characterization of this uncharacterized membrane protein.

How can I design experiments to investigate the potential role of UPF0761 membrane protein XOO3615 in bacterial pathogenicity?

Investigating the potential role of UPF0761 membrane protein XOO3615 in Xanthomonas oryzae pathogenicity requires a comprehensive experimental design:

  • Gene Knockout/Modification Strategy:

    • Generate clean deletion mutants using allelic exchange

    • Create conditional expression strains if the gene is essential

    • Develop complementation constructs with wild-type and mutant variants

    • Design constructs for site-directed mutagenesis of predicted functional sites

  • Virulence Phenotyping Framework:

    • Quantitative pathogenicity assays in rice plants

    • Measurement of bacterial growth kinetics in planta

    • Analysis of symptom development and progression

    • Comparative analysis across multiple rice cultivars

  • Molecular Mechanism Investigation:

    • Transcriptome analysis of wild-type vs. mutant bacteria during infection

    • Secretome analysis to detect changes in effector protein secretion

    • Membrane integrity and composition assessment

    • Evaluation of stress response and adaptation capabilities

  • Host Response Characterization:

    • Analysis of plant immune response markers

    • Reactive oxygen species production measurement

    • Callose deposition quantification

    • Defense gene expression profiling

  • Experimental Design Considerations:

    • Apply optimal experimental design principles to maximize information while minimizing experiments

    • Include appropriate controls for each experiment

    • Ensure adequate biological and technical replication

    • Design experiments to detect both direct and indirect effects

This systematic approach allows for comprehensive characterization of XOO3615's role in pathogenicity while maintaining experimental efficiency through optimal design principles.

What methods can be used to study the structure of UPF0761 membrane protein XOO3615?

Studying the structure of membrane proteins like UPF0761 XOO3615 requires specialized approaches:

  • Computational Structure Prediction:

    • Leverage AlphaFold or RoseTTAFold predictions as starting models

    • Assess model quality using pLDDT scores as seen with similar UPF0761 proteins

    • Refine predictions using molecular dynamics simulations

    • Validate computational models through targeted experimental approaches

  • X-ray Crystallography Strategy:

    • Screen multiple constructs with variable N- and C-terminal boundaries

    • Test fusion proteins (e.g., T4 lysozyme) to enhance crystallization

    • Optimize detergent and lipid conditions for crystal formation

    • Consider lipidic cubic phase crystallization for membrane proteins

  • Cryo-EM Approach:

    • Optimize sample preparation (detergent selection, concentration)

    • Consider protein size limitations (potential for Fab fragment complexation)

    • Implement vitrification condition screening

    • Apply image processing strategies optimized for membrane proteins

  • NMR Spectroscopy Methods:

    • Selective isotope labeling of specific domains

    • Solid-state NMR approaches for membrane-embedded regions

    • Solution NMR for soluble domains

    • Dynamics measurements to identify flexible regions

  • Integrative Structural Biology:

    • Combine low-resolution techniques (SAXS, cryo-EM) with high-resolution methods

    • Use crosslinking mass spectrometry to provide distance constraints

    • Validate structural models with functional data

    • Apply membrane topology data to constrain model building

  • Structure Validation Framework:

MethodResolution RangeAdvantagesLimitations
X-ray crystallography1.5-3.5 ÅHigh resolutionCrystallization challenges
Cryo-EM2.5-4.5 ÅNo crystallization neededSize limitations
NMRSite-specificDynamic informationSize constraints
Computational predictionModel-dependentNo experimental setupRequires validation

This multi-method approach provides complementary structural information, increasing confidence in the final structural model of UPF0761 membrane protein XOO3615.

How can I assess the potential transport function of UPF0761 membrane protein XOO3615?

Assessing potential transport function of membrane proteins like UPF0761 XOO3615 requires specialized experimental approaches:

  • Reconstitution Systems Development:

    • Proteoliposome preparation with controlled protein orientation

    • Giant unilamellar vesicle (GUV) formation for single-vesicle studies

    • Planar lipid bilayer reconstitution for electrophysiology

    • Optimization of lipid composition to match native environment

  • Transport Assay Design Matrix:

Assay TypeMeasurement MethodAdvantagesLimitations
Flux assaysFluorescence, radioactivityDirect measurementLimited to specific substrates
CounterflowIsotope exchangeSensitive detectionRequires substrate knowledge
Patch-clampElectrophysiologyReal-time kineticsTechnical complexity
FRET sensorsFluorescence microscopySpatial resolutionRequires sensor development
  • Substrate Screening Strategy:

    • Bioinformatic prediction of potential substrates

    • Development of high-throughput screening approaches

    • Testing of substrate analogs to define specificity

    • Competition assays to identify inhibitors

  • Energetic Coupling Analysis:

    • Investigation of ion gradient dependence

    • ATP requirement assessment

    • Membrane potential dependence testing

    • Thermodynamic analysis of transport process

  • Kinetic Characterization Framework:

    • Determination of transport rates under varying conditions

    • Analysis of concentration-dependent kinetics

    • Inhibition studies to define mechanism

    • Temperature dependence for thermodynamic parameters

These approaches should be implemented using optimal experimental design principles to efficiently identify transport function and characterize its mechanistic details, following similar optimization strategies used in other membrane protein studies .

What special considerations apply when developing antibodies against UPF0761 membrane protein XOO3615?

Developing antibodies against membrane proteins like UPF0761 XOO3615 presents unique challenges requiring specialized approaches:

  • Antigen Design Strategies:

    • Extramembrane domain approach: Focus on hydrophilic regions predicted to be exposed

    • Peptide-based approach: Use multiple peptides from different regions

    • Denatured protein approach: For detection in Western blots

    • Native conformation approach: Using purified protein in detergent micelles or nanodiscs

  • Immunization Protocol Optimization:

    • Selection of appropriate species based on protein conservation

    • Use of adjuvant formulations optimized for membrane proteins

    • Extended immunization schedules with careful monitoring

    • Multiple boosting strategies to enhance specificity

  • Screening and Validation Framework:

Validation MethodPurposeSuccess Criteria
ELISAInitial screeningSignal:noise >10:1
Western blotSpecificity confirmationSingle band at expected MW
ImmunoprecipitationNative protein recognitionEnrichment >5-fold
ImmunofluorescenceSubcellular localizationMembrane staining pattern
  • Common Challenges and Solutions:

    • Low immunogenicity: Use carrier proteins and optimized adjuvants

    • Cross-reactivity: Perform extensive validation against related proteins

    • Conformational epitopes: Maintain native structure during immunization

    • Accessibility issues: Target exposed regions based on topology predictions

  • Advanced Antibody Development Approaches:

    • Phage display for selection of specific binders

    • Recombinant antibody production for consistent supply

    • Nanobody development for improved membrane protein recognition

    • Antibody engineering to enhance specificity and affinity

This comprehensive approach addresses the specific challenges associated with generating antibodies against membrane proteins, increasing the likelihood of obtaining specific and useful reagents for XOO3615 research.

How can I use UPF0761 membrane protein XOO3615 as a model to study membrane protein insertion mechanisms?

Studying membrane protein insertion mechanisms using UPF0761 membrane protein XOO3615 as a model can provide valuable insights into fundamental biological processes:

  • In Vitro Translation and Insertion Systems:

    • Develop ribosome-nascent chain complexes with XOO3615

    • Reconstitute with purified insertion machinery components

    • Monitor insertion using protease protection assays

    • Apply principles from EMC research to design experimental systems

  • Insertion Pathway Identification:

    • Test dependence on SRP/Sec/YidC pathways

    • Analyze the role of the cytosolic vestibule in guiding TMDs, similar to EMC architecture

    • Investigate the intramembrane groove function in TM domain insertion

    • Characterize the energetics of insertion processes

  • Sequential Insertion Analysis:

    • Create translation intermediates of increasing length

    • Map interactions with insertion machinery at each stage

    • Develop a temporal model of insertion process

    • Compare with known insertion mechanisms of other membrane proteins

  • Structure-Function Relationship Studies:

    • Generate systematic mutations in transmembrane domains

    • Identify critical residues for proper membrane insertion

    • Correlate insertion efficiency with physiochemical properties

    • Develop predictive models for insertion signals

  • Integration with Computational Approaches:

    • Molecular dynamics simulations of insertion process

    • Free energy calculations for membrane partitioning

    • Comparison with other UPF0761 family members

    • Development of generalizable principles for membrane protein biogenesis

This research approach leverages insights from recent advances in understanding membrane protein insertion mechanisms, such as those derived from EMC studies , providing a framework to elucidate the biogenesis pathways for UPF0761 family proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.