Recombinant UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will fulfill your request to the best of our ability.
Lead Time
The delivery timeframe may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yihY; Z5425; ECs4809; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links

KEGG: ece:Z5425

STRING: 155864.Z5425

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant UPF0761 membrane protein yihY?

Recombinant UPF0761 membrane protein yihY is a membrane protein derived from Escherichia coli, particularly studied in strains like 55989/EAEC. It belongs to the UPF0761 protein family, with the UPF designation indicating an uncharacterized protein family. For research applications, this protein is typically produced in heterologous expression systems where the protein can be tagged and modified to facilitate purification and characterization. The recombinant protein is frequently expressed as amino acids 1-290, potentially representing the full-length protein or a specific domain of interest .

What experimental strategies are most effective for determining yihY protein function?

Since yihY is classified as an uncharacterized protein, a multi-faceted approach is necessary to elucidate its function:

  • Comparative genomics to identify conserved domains and potential functions

  • Gene knockout studies to observe phenotypic effects

  • Protein-protein interaction studies to identify binding partners

  • Subcellular localization experiments to determine membrane distribution

  • Biochemical assays to test for specific enzymatic activities

When designing experiments, researchers should consider that, like other membrane proteins, yihY may require specific membrane environments to maintain its native function. Drawing from approaches used with other membrane proteins, amphipol-based delivery systems might allow incorporation of yihY into model membrane systems for functional studies .

How do expression conditions affect yihY protein yield and quality?

Expression conditions critically impact both yield and quality of recombinant yihY protein:

Expression ParameterEffect on YieldEffect on QualityOptimization Strategy
Induction strengthHigher induction may increase yield but risk aggregationStrong induction can lead to misfolded proteinUse tunable promoters (e.g., rhamnose-based) to balance expression levels
TemperatureLower temperatures typically reduce yield but improve foldingLower temperatures enhance proper membrane insertionOptimize between 16-30°C depending on construct
Host strainSpecialized strains can improve yieldC41/C43 strains may reduce toxicity and improve foldingTest multiple strains including those optimized for membrane proteins
Media compositionRich media increases biomass and potential yieldDefined media may provide more consistent qualityBalance between growth rate and protein quality

Research on other bacterial membrane proteins suggests that harmonizing secretory protein production rates with the capacity of the Sec-translocon is critical for optimal expression, and can be achieved by carefully controlling induction conditions .

Which expression systems are most suitable for producing functional recombinant yihY protein?

Multiple expression systems can be employed for yihY production, each with distinct advantages:

  • E. coli: As yihY is native to E. coli, homologous expression may preserve native folding and functionality. E. coli can be genetically modified to enhance protein translocation capacity by increasing levels of components like SecA, LepB, and YidC, which have been shown to increase in response to recombinant protein production demands .

  • Yeast: Offers eukaryotic processing machinery while maintaining relatively high yields.

  • Baculovirus/insect cells: Provides higher eukaryotic processing with good membrane protein folding capacity.

  • Mammalian cells: Offers the most sophisticated processing machinery but with lower yields .

For most research applications, E. coli remains the starting point due to its simplicity and cost-effectiveness, with other systems considered if functional expression is not achieved.

What purification strategies overcome the challenges associated with membrane proteins like yihY?

Purification of yihY requires specialized approaches to address the challenges inherent to membrane proteins:

  • Membrane isolation: Differential centrifugation following cell lysis to isolate membrane fractions containing yihY.

  • Solubilization optimization: Screen various detergents (DDM, LMNG, CHAPS) to extract yihY while preserving its native structure. Amphipols may provide an alternative to traditional detergents, as they can solubilize and stabilize membrane proteins without disrupting membranes .

  • Affinity chromatography: If yihY is expressed with tags (e.g., His₆), immobilized metal affinity chromatography (IMAC) can be employed for selective purification.

  • Size exclusion chromatography: Critical for achieving monodisperse protein preparations and removing protein aggregates.

  • Stability assessment: Thermal shift assays to identify buffer conditions that enhance protein stability.

The amphipol approach demonstrated with SARS-CoV-2 envelope protein might be applicable to yihY, as it allowed the recombinant protein to be stripped of lipid and detergent while maintaining solubility through complexation with amphipols .

How can researchers validate the structural integrity of purified yihY protein?

Validating structural integrity requires multiple complementary approaches:

When designing fusion proteins for structural studies, molecular dynamics simulations can help predict whether the recombinant construct will maintain native secondary structure elements, such as α-helical conformations that might be critical for function .

What techniques provide the most reliable structural data for membrane proteins like yihY?

Several complementary techniques can generate structural insights into yihY:

  • Cryo-electron microscopy (cryo-EM): Increasingly the method of choice for membrane proteins, allowing visualization without crystallization. Sample preparation typically involves purification in detergent micelles or nanodiscs.

  • X-ray crystallography: Despite challenges in crystallizing membrane proteins, this approach can provide atomic-resolution structures. Strategies include using crystallization chaperones or lipidic cubic phase crystallization.

  • NMR spectroscopy: Useful for dynamics studies and structure determination of smaller membrane proteins or domains.

  • Molecular dynamics simulations: Can predict structural stability and dynamics based on sequence information or homology models, helping to identify stable structural elements such as alpha helices that might be present in yihY .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information on solvent accessibility and conformational dynamics without requiring crystallization.

The choice of method depends on research goals, with lower-resolution techniques often providing valuable insights when high-resolution structures are challenging to obtain.

How can researchers investigate the membrane topology and orientation of yihY?

Determining how yihY is arranged within the membrane requires specialized approaches:

  • Experimental methods:

    • Substituted cysteine accessibility method (SCAM): Introducing cysteines at various positions and testing their accessibility to membrane-impermeable reagents

    • Protease protection assays: Regions accessible to proteases are likely extracellular or cytoplasmic

    • Reporter fusion analysis: Fusing reporter proteins (GFP, PhoA) to different regions to determine their cellular localization

    • Antibody epitope mapping: Determining which regions are accessible from either side of the membrane

  • Computational prediction:

    • Transmembrane prediction algorithms (TMHMM, TOPCONS)

    • Hydropathy analysis to identify potential membrane-spanning regions

    • Evolutionary analysis to identify conserved topological features

Fluorescent tagging approaches similar to those used for the SARS-CoV-2 envelope protein could track yihY trafficking in cells, providing insights into its localization and potentially its topology .

What approaches can identify potential interaction partners of yihY protein?

Identifying interaction partners can provide crucial functional insights:

  • In vitro methods:

    • Pull-down assays using tagged yihY as bait

    • Surface plasmon resonance (SPR) to measure binding kinetics, which has successfully detected binding between recombinant membrane proteins and their antibodies with nanomolar affinities

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of interactions

  • Cell-based methods:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins

    • Flow cytometry can validate binding of antibodies or other proteins to membrane-embedded yihY, as demonstrated with other membrane transporters

  • Computational approaches:

    • Protein-protein interaction predictions

    • Co-evolution analysis to identify potentially interacting protein pairs

    • Genomic context and gene neighborhood analysis

When studying interactions, maintaining yihY in a native-like membrane environment is crucial for preserving physiologically relevant interactions.

How should researchers design control experiments when studying yihY function?

Robust control experiments are essential for reliable results:

  • Expression controls:

    • Empty vector controls to account for effects of the expression system

    • Expression of an unrelated membrane protein to control for general effects of membrane protein overproduction

    • Monitoring SecA, LepB, and YidC levels, as these can increase in response to recombinant membrane protein production and affect experimental outcomes

  • Purification controls:

    • Purification of membrane fractions from non-expressing cells

    • Parallel purification of a well-characterized membrane protein as a positive control

  • Functional assays:

    • Include positive controls with known activity

    • Test multiple buffer conditions to ensure optimal protein function

    • Include detergent-only controls when using membrane mimetics

  • Interaction studies:

    • Use scaffold proteins alone as controls when studying fusion proteins containing yihY domains

    • Include non-specific binding controls in pull-down experiments

    • Validate interactions using multiple independent methods

These controls help distinguish true biological functions from artifacts related to the experimental system.

What are common pitfalls in membrane protein research applicable to yihY studies?

Several challenges commonly encountered with membrane proteins should be anticipated:

  • Expression issues:

    • Toxicity due to overexpression disrupting membrane integrity

    • Inclusion body formation instead of membrane integration

    • Improper folding leading to non-functional protein

  • Purification challenges:

    • Detergent-induced conformational changes affecting function

    • Co-purification of tightly bound lipids affecting homogeneity

    • Oligomerization or aggregation during concentration steps

  • Functional characterization issues:

    • Difficulty distinguishing specific from non-specific activities

    • Detergent interference with activity assays

    • Loss of essential lipid interactions affecting function

  • Structural biology challenges:

    • Conformational heterogeneity complicating structural studies

    • Difficulty obtaining sufficient protein for structural analysis

    • Protein instability during lengthy data collection

Research with other membrane proteins shows that adapting expression conditions to balance protein production with the cell's capacity for membrane protein insertion and folding is critical for success. This may involve monitoring and potentially enhancing components of the Sec translocation pathway .

How can researchers troubleshoot poor expression or misfolding of recombinant yihY?

Systematic troubleshooting strategies can address common expression problems:

  • Optimizing expression conditions:

    • Test different induction methods (concentration, timing, temperature)

    • Screen multiple E. coli strains, including those specialized for membrane proteins

    • Utilize tunable promoters (like rhamnose-based systems) that allow precise control of expression levels

    • Consider co-expression of chaperones or components of the Sec translocation machinery

  • Modifying protein constructs:

    • Test various fusion tags that may enhance folding or stability

    • Create truncated constructs if full-length protein is problematic

    • Optimize codon usage for the expression host

    • Consider fusion to well-folded soluble domains

  • Membrane environment optimization:

    • Supplement growth media with specific lipids that might enhance membrane protein folding

    • Test expression in the presence of specific additives (glycerol, arginine)

    • Evaluate different detergents for extraction and purification

  • Folding assessment:

    • Monitor protein trafficking to ensure proper membrane localization

    • Assess oligomeric state as an indicator of proper folding

    • Evaluate secondary structure content using spectroscopic methods

Studies have shown that E. coli can adapt its protein translocation machinery in response to recombinant protein production demands, suggesting that sequential expression attempts may benefit from cellular adaptation .

How might computational approaches complement experimental studies of yihY?

Computational methods offer valuable insights that can guide experimental work:

  • Sequence analysis:

    • Profile-based searches to identify distant homologs with known functions

    • Identification of conserved residues that might be functionally important

    • Co-evolution analysis to predict residue contacts and potential binding partners

  • Structure prediction:

    • Template-based or ab initio modeling of yihY structure

    • Molecular dynamics simulations to study stability and dynamics

    • Simulations can predict the stability of structural elements such as alpha helices, which might be critical for function

  • Function prediction:

    • Identification of potential binding pockets or catalytic sites

    • Virtual screening for potential ligands or substrates

    • Systems biology approaches to place yihY in functional networks

  • Experimental design guidance:

    • Identifying optimal construct boundaries for expression

    • Predicting potentially stabilizing mutations

    • Designing site-directed mutagenesis experiments

Integrating computational predictions with targeted experimental validation represents a powerful approach for studying uncharacterized membrane proteins like yihY.

What emerging technologies might accelerate research on membrane proteins like yihY?

Several cutting-edge technologies show promise for membrane protein research:

  • Single-particle cryo-EM advances:

    • Direct electron detectors with improved sensitivity

    • Phase plates for enhanced contrast of smaller proteins

    • Automated data collection and processing pipelines

  • Novel membrane mimetics:

    • Styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Engineered nanodiscs with customized lipid compositions

    • Amphipol-based delivery systems that allow membrane protein solubilization without traditional detergents

  • Miniaturized screening platforms:

    • Microfluidic devices for parallel screening of crystallization conditions

    • Droplet-based assays for high-throughput functional testing

    • Automated membrane protein purification systems

  • Advanced mass spectrometry:

    • Native mass spectrometry for intact membrane protein complexes

    • Cross-linking mass spectrometry for structural constraints

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Artificial intelligence applications:

    • Deep learning for improved structure prediction

    • Machine learning for optimizing expression and purification conditions

    • Automated image analysis for structural studies

Amphipol-based approaches, as demonstrated with the SARS-CoV-2 envelope protein, might be particularly valuable as they allow membrane proteins to be stripped of lipid and detergent while maintaining solubility .

How can yihY research contribute to broader understanding of bacterial membrane biology?

Studies of yihY can provide insights into several aspects of bacterial membrane biology:

  • Membrane protein biogenesis:

    • Understanding how uncharacterized membrane proteins are integrated into bacterial membranes

    • Studying how E. coli adapts its protein translocation machinery in response to membrane protein expression

    • Identifying factors that influence membrane protein folding and stability

  • Bacterial physiology:

    • Determining the role of uncharacterized membrane proteins in cell function

    • Understanding how membrane proteome complexity contributes to bacterial adaptability

    • Exploring potential roles in stress responses or environmental adaptation

  • Evolutionary considerations:

    • Studying how uncharacterized membrane protein families evolve across bacterial species

    • Identifying conserved features that might indicate fundamental functions

    • Understanding the diversity of membrane protein architectures

  • Methodological advances:

    • Developing improved approaches for studying challenging membrane proteins

    • Establishing protocols for functional annotation of uncharacterized membrane proteins

    • Creating new tools for membrane protein delivery and analysis, such as amphipol-based delivery systems

Research on yihY thus contributes both specific knowledge about this protein and broader insights into membrane protein biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.