Recombinant UPF0761 membrane protein YPTB0027 (YPTB0027)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0761 Membrane Protein YPTB0027

UPF0761 membrane protein YPTB0027 (designated by UniProt ID Q66GF5) is a full-length protein consisting of 294 amino acids derived from Yersinia pseudotuberculosis Serotype I . As a membrane protein, it belongs to the "Uncharacterized Protein Family" (UPF) 0761, a designation given to proteins whose functions have not yet been fully determined through experimental analysis. Yersinia pseudotuberculosis is known to cause intestinal infection with the ability to spread to the liver, where it can induce hemosiderosis, abscesses, and hepatitis . This bacterium employs various protein-based mechanisms to evade host immune responses, which makes the study of its membrane proteins particularly relevant for understanding pathogenicity mechanisms.

The protein is classified as a membrane protein, suggesting its integration into the bacterial cell membrane. Membrane proteins play crucial roles in cellular processes including transport, signal transduction, cell-cell communication, and maintenance of cellular structure. Given its source organism's pathogenic nature, YPTB0027 may potentially be involved in virulence mechanisms, though this remains to be conclusively demonstrated. The recombinant version of this protein is typically produced with histidine tags to facilitate purification and downstream applications.

Recombinant Expression and Purification Methods

The recombinant expression of membrane proteins presents significant challenges due to their hydrophobic nature and tendency to aggregate during expression. For UPF0761 membrane protein YPTB0027, expression in E. coli has been successfully achieved, resulting in functional protein for research applications . The production process typically employs bacterial expression systems optimized for membrane protein expression.

When expressing membrane proteins like YPTB0027, it is advisable to moderate expression levels to prevent saturation of the membrane protein biogenesis pathway, which can lead to cell death or inclusion body formation . Specialized expression strains such as Lemo21(DE3) allow for tunable T7 expression to achieve optimal assembly of transmembrane proteins. In standard T7 expression strains like BL21(DE3), transcription may be too robust and difficult to control. By contrast, Lemo21(DE3) expresses a T7 RNA polymerase inhibitor protein (LysY) that enables precise regulation of target gene transcription .

After expression, the recombinant YPTB0027 protein requires careful extraction from cellular membranes, typically using detergents that maintain protein stability and native conformation. The presence of an N-terminal histidine tag facilitates purification through immobilized metal affinity chromatography (IMAC) . Following purification, the protein is typically lyophilized for long-term storage stability.

The recommended reconstitution protocol involves:

  1. Brief centrifugation of the vial prior to opening

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol (5-50% final concentration) for long-term storage

  4. Aliquoting to avoid repeated freeze-thaw cycles

  5. Storage at -20°C/-80°C

Quality Assessment and Characterization

The quality of recombinant UPF0761 membrane protein YPTB0027 can be assessed through various analytical techniques to ensure proper folding, purity, and functionality. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) is commonly employed to verify protein purity, with commercial preparations typically achieving greater than 90% purity . This level of purity is essential for downstream applications that require high-quality protein samples.

Beyond basic purity assessment, more sophisticated techniques may be employed to characterize the structural and functional properties of YPTB0027. Circular dichroism spectroscopy can provide insights into secondary structure content, particularly the alpha-helical regions that predominate in membrane proteins. Mass spectrometry confirms the protein's molecular weight and can detect post-translational modifications or truncations.

For membrane proteins like YPTB0027, functional characterization often requires reconstitution into artificial membrane systems such as liposomes or nanodiscs that mimic the native lipid environment. These reconstitution systems allow for the assessment of potential transport or signaling functions. While specific functional assays for YPTB0027 have not been widely reported in the literature, general approaches for membrane protein characterization would apply to this protein as well.

Comparative Analysis with Related UPF0761 Family Proteins

The UPF0761 protein family includes several membrane proteins across different bacterial species. A related protein, UPF0761 membrane protein LHK_02978 from Laribacter hongkongensis (UniProt ID: C1D515), shares sequence and structural similarities with YPTB0027 . Comparative analysis of these related proteins can provide insights into conserved domains and potential functional roles within this protein family.

FeatureYPTB0027 (Y. pseudotuberculosis)LHK_02978 (L. hongkongensis)
Length294 amino acids422 amino acids
UniProt IDQ66GF5C1D515
Expression HostE. coliVarious expression systems
Source OrganismPathogenic bacteriaGram-negative bacterium
Transmembrane RegionsMultipleMultiple
Tag OptionsN-terminal His tagVarious tag options

The sequence comparison between these proteins may reveal conserved motifs that could be essential for function, potentially providing clues about the biological role of this protein family. While YPTB0027 is derived from a known human pathogen (Y. pseudotuberculosis), LHK_02978 comes from L. hongkongensis, which has been associated with gastroenteritis. The presence of similar proteins in different pathogenic bacteria suggests potential roles in bacterial survival or virulence, though specific functions remain to be elucidated.

Challenges in Membrane Protein Research and Expression

Membrane proteins like UPF0761 membrane protein YPTB0027 present significant challenges in research and expression compared to soluble proteins. These challenges stem from their hydrophobic nature, which often leads to aggregation and misfolding during expression . Understanding these challenges is crucial for researchers working with this protein.

The expression of membrane proteins in cellular systems can result in protein aggregation due to the hydrophobic nature of transmembrane segments. When using E. coli as a host for YPTB0027 expression, moderation of expression levels is advantageous to prevent saturation of the membrane protein biogenesis pathway . Overexpression can lead to cell death or inclusion body formation, resulting in non-functional protein.

Several strategies have been developed to overcome these challenges:

  1. Specialized expression strains like Lemo21(DE3) that allow for tunable expression levels

  2. Optimization of induction conditions, including temperature, inducer concentration, and duration

  3. Use of fusion partners that enhance solubility or membrane insertion

  4. Development of detergent screening methods to identify optimal conditions for extraction and purification

  5. Reconstitution into lipid bilayers or detergent micelles to maintain native conformation

The hydrophobic nature of membrane proteins also presents challenges for structural studies. Traditional techniques like X-ray crystallography require the protein to be extracted from its membrane environment and stabilized in detergent micelles, which can affect native conformation. Recent advances in cryo-electron microscopy have provided alternative approaches for structural determination of membrane proteins in environments closer to their native state.

Potential Biological Functions and Research Applications

While the specific biological functions of UPF0761 membrane protein YPTB0027 remain largely uncharacterized, its presence in the pathogenic bacterium Y. pseudotuberculosis suggests potential roles in bacterial physiology or pathogenesis. Y. pseudotuberculosis causes intestinal infections and can spread to the liver, where it induces various pathological conditions . The bacterium is known to express proteins that suppress phagocytic activity to evade the host immune response .

As a membrane protein, YPTB0027 could potentially be involved in:

  1. Transport of molecules across the bacterial membrane

  2. Cell signaling and response to environmental changes

  3. Maintenance of membrane integrity

  4. Interaction with host cells during infection

  5. Resistance to antimicrobial compounds

Research applications for recombinant YPTB0027 include:

  1. Structural studies to determine three-dimensional organization

  2. Functional characterization through reconstitution in artificial membrane systems

  3. Development of antibodies for detection and localization studies

  4. Screening for small molecules that interact with the protein as potential antimicrobial agents

  5. Comparative studies with related proteins from other pathogenic bacteria

Understanding the function of YPTB0027 could provide insights into bacterial pathogenesis mechanisms and potentially identify new targets for therapeutic intervention. The availability of recombinant forms of this protein facilitates such research by providing pure protein samples for various experimental approaches.

References

  1. Creative BioMart. Recombinant Full Length Upf0761 Membrane Protein Yptb0027(Yptb0027) Protein, His-Tagged. Product information from Creative BioMart catalog RFL2418YF .

  2. Creative BioMart. Full Length Protein - Background and Case Studies. Information on the importance and challenges of full-length protein expression and applications .

  3. Colorectal Research. ELISA Recombinant Laribacter hongkongensis UPF0761 membrane protein LHK_02978 (LHK_02978). Product information for a related UPF0761 family protein .

  4. New England Biolabs. Membrane Protein Expression. Technical information on challenges and strategies for membrane protein expression .

  5. Xiahepublishing. Phagocyte-targeted Effects of Yersinia pseudotuberculosis Proteins. Research on Y. pseudotuberculosis pathogenicity mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prefer to ship the format currently in stock, we will fulfill any specific format requests. Please indicate your desired format when placing the order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please notify us in advance. Additional fees will apply for dry ice shipping.
Notes
Repeated freezing and thawing of the protein is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting the protein for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YPTB0027; UPF0761 membrane protein YPTB0027
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
YPTB0027
Target Protein Sequence
MASFRRFRLLSPLKPCVTFGRMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAA FPMFAEISIKLKAFIFANFMPATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSV DSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVISSYLLSLHWLAHARVDSMID EILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSY QLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAERHHAKSVITQSPEM
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for expressing recombinant YPTB0027 in E. coli?

For successful expression of YPTB0027 in E. coli, researchers should consider a methodological approach that addresses the challenges of membrane protein expression:

  • Strain selection: BL21(DE3) derivatives with enhanced membrane protein expression capabilities are recommended.

  • Temperature optimization: Lower induction temperatures (16-20°C) often improve folding of membrane proteins.

  • Fusion tags: The N-terminal His-tag approach has proven successful for YPTB0027 as demonstrated in commercial preparations .

  • Induction parameters: Using lower IPTG concentrations (0.1-0.5 mM) and longer induction periods (16-20 hours) at reduced temperatures improves yield of correctly folded protein.

  • Media supplementation: Addition of glycerol (0.5-1%) can enhance membrane protein stability during expression.

The optimization process should include small-scale expression trials monitoring protein yield and solubility using western blot analysis before scaling up to larger cultures.

What purification strategies are most effective for obtaining high-purity YPTB0027?

Purification of membrane proteins like YPTB0027 requires specialized approaches:

  • Membrane isolation: Following cell lysis, differential centrifugation should be used to isolate membrane fractions.

  • Solubilization: Detergent screening is critical - mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) at concentrations just above their CMC (critical micelle concentration) are typically effective.

  • Affinity chromatography: For His-tagged YPTB0027, IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resins with detergent in all buffers is the primary purification step .

  • Size exclusion chromatography: A secondary purification step to remove aggregates and achieve >90% purity as verified by SDS-PAGE .

  • Quality assessment: Purity assessment via SDS-PAGE should show a single predominant band corresponding to the expected molecular weight of YPTB0027 (approximately 32-35 kDa including the His-tag).

Commercial preparations typically achieve >85-90% purity using these methods, as confirmed by SDS-PAGE analysis .

What are the optimal storage conditions for maintaining YPTB0027 stability long-term?

Long-term stability of YPTB0027 depends on proper storage conditions tailored to the preparation format:

  • Lyophilized form:

    • Store at -20°C/-80°C

    • Expected shelf life: 12 months under these conditions

    • Should be protected from moisture and light

  • Liquid form:

    • Store at -20°C/-80°C in appropriate buffer

    • Expected shelf life: approximately 6 months

    • Addition of 50% glycerol is recommended as a cryoprotectant

  • Working aliquots:

    • Can be stored at 4°C for up to one week

    • Repeated freeze-thaw cycles should be strictly avoided

For research requiring prolonged use of the same batch, preparing multiple small-volume aliquots is strongly recommended to minimize freeze-thaw cycles and maintain protein integrity.

What is the recommended reconstitution protocol for lyophilized YPTB0027?

A detailed reconstitution protocol for lyophilized YPTB0027 includes the following methodological steps:

  • Initial preparation:

    • Equilibrate the vial to room temperature (15-25°C)

    • Brief centrifugation to bring contents to the bottom of the vial

  • Reconstitution:

    • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • Gentle mixing through swirling or inversion (avoid vigorous shaking)

    • Allow 5-10 minutes for complete dissolution

  • Stabilization:

    • Add glycerol to a final concentration of 5-50% (standard recommendation is 50%)

    • Mix thoroughly but gently

  • Aliquoting:

    • Divide into single-use aliquots

    • Flash freeze in liquid nitrogen

    • Transfer to -20°C/-80°C for long-term storage

This protocol minimizes potential damage to the protein structure while ensuring optimal stability for downstream applications.

How can YPTB0027 be effectively incorporated into artificial membrane systems for functional studies?

For functional characterization, YPTB0027 can be incorporated into various membrane mimetic systems using these methodological approaches:

  • Liposome reconstitution:

    • Prepare liposomes using E. coli polar lipid extract or synthetic lipid mixtures (POPE:POPG at 3:1 ratio)

    • Solubilize liposomes with mild detergent (0.5% Triton X-100)

    • Add purified YPTB0027 at protein:lipid ratio of 1:100 to 1:1000

    • Remove detergent via Bio-Beads or dialysis

    • Verify incorporation by density gradient centrifugation

  • Nanodiscs preparation:

    • Select appropriate MSP (Membrane Scaffold Protein) variant based on YPTB0027 size

    • Mix MSP, lipids, and YPTB0027 in optimal ratios

    • Remove detergent using Bio-Beads

    • Purify nanodiscs by size exclusion chromatography

    • Confirm homogeneity by dynamic light scattering

  • Planar lipid bilayers:

    • Form bilayers using the painting or folding method

    • Add proteoliposomes containing YPTB0027 near the bilayer

    • Induce fusion using osmotic gradients or calcium ions

    • Monitor incorporation using electrical measurements if transport function is suspected

These methods provide complementary approaches for studying YPTB0027 function in controlled membrane environments, essential for elucidating its biological role.

What are the most effective approaches for studying YPTB0027 interactions with other proteins?

To investigate YPTB0027's protein-protein interactions, researchers should consider these methodological approaches:

  • Pull-down assays: Using His-tagged YPTB0027 as bait with Ni-NTA resin to capture potential binding partners from cellular lysates, followed by mass spectrometry analysis .

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified YPTB0027 on sensor chips via His-tag

    • Flow potential interacting proteins at various concentrations

    • Analyze binding kinetics and affinity constants

  • Crosslinking coupled with mass spectrometry:

    • Use membrane-permeable crosslinkers like DSS or photo-activatable crosslinkers

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify interaction interfaces using specialized software

  • Biolayer Interferometry:

    • Immobilize YPTB0027 on biosensors

    • Measure association and dissociation of putative binding partners

    • Determine binding constants and kinetics in real-time

  • Co-immunoprecipitation with epitope-tagged constructs:

    • Express YPTB0027 with epitope tags in heterologous systems

    • Perform immunoprecipitation with tag-specific antibodies

    • Identify co-precipitating proteins by western blot or mass spectrometry

These approaches should be used complementarily to build a comprehensive interaction network for YPTB0027.

What structural prediction methods are most appropriate for membrane proteins like YPTB0027?

For predicting the structure of membrane proteins like YPTB0027, researchers should employ a multi-faceted approach:

  • AI-based structure prediction:

    • AlphaFold2 and RoseTTAFold have revolutionized membrane protein structure prediction

    • These tools can generate reliable models even without homologous structures

    • Multiple runs with different parameters should be performed to assess model confidence

  • Transmembrane topology prediction:

    • TMHMM, HMMTOP, and Phobius can predict membrane-spanning regions

    • Consensus from multiple algorithms increases prediction confidence

    • For YPTB0027, analysis of its sequence suggests multiple transmembrane domains based on hydrophobicity patterns

  • Evolutionary coupling analysis:

    • Methods like EVfold use co-evolution signals to predict contacts

    • Particularly useful for membrane proteins with limited structural data

    • Requires diverse sequence alignments of homologous proteins

  • Hybrid approaches:

    • Combining low-resolution experimental data (crosslinking, EPR) with computational models

    • Integrating biochemical constraints to refine predicted structures

    • Using molecular dynamics simulations to assess stability in membrane environments

When applied to YPTB0027, these methods would help elucidate its likely structural organization and potential functional sites before undertaking more resource-intensive experimental structure determination.

What experimental techniques are most suitable for determining the membrane topology of YPTB0027?

Determining the membrane topology of YPTB0027 requires specialized experimental approaches:

The results from these complementary methods should be integrated to build a consensus topology model of YPTB0027 in membrane environments.

What are common challenges in YPTB0027 expression and purification, and how can they be addressed?

Researchers working with YPTB0027 may encounter several challenges that require specific troubleshooting approaches:

ChallengePossible CausesSolution StrategiesReference
Low expression yieldToxicity to host cells, protein aggregationUse tightly controlled induction systems, lower temperatures (16°C), specialized host strains (C41/C43)
Protein aggregationImproper folding, inadequate detergentScreen multiple detergents, include stabilizing agents (glycerol, specific lipids)
Poor solubilizationInsufficient detergent concentration, inappropriate detergent choiceSystematic detergent screening, optimize detergent:protein ratio
Degradation during purificationProtease contamination, protein instabilityAdd protease inhibitors, maintain cold temperatures, minimize purification time
Loss of activityDelipidation, detergent effects on structureSupplement with specific lipids, consider gentle detergents (LMNG, GDN)

Employing these strategies in a systematic manner can significantly improve the success rate when working with challenging membrane proteins like YPTB0027.

How can researchers verify the structural integrity and functionality of purified YPTB0027?

Quality control of purified YPTB0027 should include multiple orthogonal methods to ensure structural integrity:

  • Size exclusion chromatography (SEC):

    • Monodisperse peak indicates properly folded protein

    • Aggregation or multiple peaks suggest heterogeneity issues

    • SEC coupled with multi-angle light scattering (SEC-MALS) can determine oligomeric state

  • Circular dichroism (CD) spectroscopy:

    • Provides secondary structure information

    • Alpha-helical content should match predictions for membrane proteins

    • Thermal stability can be assessed by temperature-dependent CD

  • Fluorescence spectroscopy:

    • Intrinsic tryptophan fluorescence monitors tertiary structure

    • Changes in emission maxima indicate alterations in protein folding

    • Can be used for ligand binding studies if applicable

  • Limited proteolysis:

    • Properly folded proteins show characteristic digestion patterns

    • Compares digestion patterns of different preparations

    • Identifies stable domains and flexible regions

  • Negative-stain electron microscopy:

    • Visual confirmation of protein homogeneity

    • Detection of aggregation or degradation

    • Initial assessment before more detailed structural studies

These quality control measures should be implemented routinely to ensure that experimental results with YPTB0027 are reliable and reproducible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.