Recombinant Ureaplasma parvum serovar 3 ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Ureaplasma parvum and ATP Synthase

Ureaplasma parvum is a species of bacteria belonging to the genus Ureaplasma, which are part of the Mycoplasmataceae family . These microorganisms are known for their ability to hydrolyze urea, using it as a metabolic substrate to generate ATP (adenosine triphosphate), the primary energy currency of cells . Ureaplasma species, including U. parvum, are commonly found as commensals in healthy individuals but can also be associated with various clinical conditions, such as non-gonococcal urethritis, pelvic inflammatory disease, and adverse pregnancy outcomes .

ATP synthase, also known as F-ATPase, is a vital enzyme complex found in the membranes of bacteria, mitochondria, and chloroplasts . It plays a crucial role in energy production by synthesizing ATP from adenosine diphosphate (ADP) and inorganic phosphate, driven by a proton gradient across the membrane . The enzyme consists of two main functional units: the F0 sector, which is embedded in the membrane and facilitates proton translocation, and the F1 sector, which catalyzes the ATP synthesis .

Recombinant Ureaplasma parvum serovar 3 ATP synthase subunit b (atpF)

Recombinant Ureaplasma parvum serovar 3 ATP synthase subunit b (atpF) refers to the genetically engineered form of the ATP synthase subunit b, derived from serovar 3 of U. parvum . This recombinant protein is produced using in vitro expression systems, often utilizing E. coli, to generate a purified form of the protein for research and industrial applications .

2.1. Function and Structure

The ATP synthase subunit b (atpF) is a component of the F0 sector of the ATP synthase complex. It is essential for the structural integrity and function of the ATP synthase, acting as a stalk that connects the F1 and F0 sectors . The atpF subunit is involved in proton translocation across the membrane, which drives the rotation of the F0 sector and, consequently, ATP synthesis by the F1 sector .

2.2. Gene and Protein Information

FeatureDescription
SpeciesUreaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Gene NameatpF
Ordered Locus NameUPA3_0141
Protein NamesATP synthase subunit b, ATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b
UniProt IDB1AIC4
Expression Region28-205
AA SequenceCTGDIPELNPAEIINTLFPNVWVFIAQVIAMCVVFSLVLWLVWKPTNKMLDKRREYIAKEITDAENAKQEALQYLENAKSEHLAAQAQTLEIIAKAKSESLTLRESLEKEAREAADKIISSAKISIANERRENLERLQSEAREAAYIAAEALMKKELSREDNDKLVDQFIKELENNEK

Production and Characteristics of Recombinant atpF

The recombinant atpF subunit is typically produced in E. coli expression systems. The gene encoding atpF is cloned into an expression vector, which is then transformed into E. coli cells. The expression of the atpF gene is induced, leading to the production of the recombinant protein, which is then purified using various chromatographic techniques .

3.1. Key Properties

  • Source: In vitro E. coli expression system

  • Purity: High purity achieved through purification processes

  • Tag Information: The specific tag type is determined during the production process

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Storage Conditions: Store at -20°C; for extended storage, conserve at -20°C or -80°C. Avoid repeated freezing and thawing. Working aliquots can be stored at 4°C for up to one week .

Research Applications

Recombinant U. parvum serovar 3 atpF has several research applications, including:

  1. Structural Studies: The purified recombinant protein can be used for structural studies to elucidate the detailed molecular structure of the ATP synthase subunit b . Techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy can be employed.

  2. Functional Studies: Recombinant atpF can be utilized in functional assays to investigate its role in ATP synthesis and proton translocation. These studies can provide insights into the mechanism of ATP synthase and the effects of mutations or inhibitors on its activity .

  3. Drug Discovery: The atpF subunit is a potential target for developing new antimicrobial agents against U. parvum. Recombinant atpF can be used in high-throughput screening assays to identify compounds that inhibit its function .

  4. Vaccine Development: As a conserved protein, atpF can be explored as a potential vaccine candidate. Recombinant atpF can be used to elicit an immune response and evaluate its protective efficacy in animal models .

Transposon Mutagenesis and Gene Disruption

Transposon mutagenesis has been employed to disrupt genes in U. parvum, including those involved in ATP synthesis. This technique involves the insertion of a mobile genetic element (transposon) into the bacterial genome, which can disrupt gene function and lead to phenotypic changes .

5.1. Method

  • A Tn4001-based mini-transposon plasmid containing a gentamicin resistance selection marker is used to transform U. parvum .

  • A polyethylene glycol-transformation enhancing protocol is utilized to enhance transformation efficiency .

  • PCR probing and sequencing are used to confirm transposon insertion and identify disrupted genes .

5.2. Phenotypic Alterations

Disruption of specific genes via transposon mutagenesis can result in observable phenotypic alterations. For example, disruption of a DEAD-box RNA helicase (UU582) in U. parvum has been shown to alter growth kinetics .

Serum Resistance Mechanisms

Ureaplasma species can develop resistance to serum, which involves multiple mechanisms, including changes in protein expression and post-translational modifications.

6.1. Candidate Proteins

  • Elongation Factor Tu Protein: This protein has been found to be immunogenic and exhibits altered pI isoforms in serum-resistant strains, suggesting a role in serum resistance mechanisms .

  • 41 kDa Protein (UUR10_0137): This novel protein is uniquely expressed in serum-resistant strains and is thought to function as a complement regulator or inhibitor, protecting Ureaplasma from complement attack .

Ureaplasma parvum in Recombinase Polymerase Amplification (RPA)

Recombinase Polymerase Amplification (RPA) is a rapid and sensitive isothermal DNA amplification technique used for the detection of various pathogens, including U. parvum . In RPA, the UvsX protein binds to DNA primers in the presence of ATP, forming a nucleoprotein complex. The UvsY protein aids in this process. The amplified products can be analyzed using agarose gel electrophoresis .

7.1. RPA Reaction Components

  • UvsX protein

  • UvsY protein

  • Gp32 protein

  • H1-Pol

  • CK

  • DTT

  • PEG35000

  • ATP

  • dNTPs

  • Tris-HCl buffer

  • Magnesium acetate

7.2. UvsY Concentration Effects

The concentration of UvsY protein can affect the efficiency of the RPA reaction. An optimal concentration of UvsY is crucial for balancing the binding and dissociation of UvsX from the DNA primer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; UU135; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-205
Protein Length
Full Length of Mature Protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
atpF
Target Protein Sequence
CTGDIPELNPAEIINTLFPNVWVFIAQVIAMCVVFSLVLWLVWKPTNKMLDKRREYIAKE ITDAENAKQEALQYLENAKSEHLAAQAQTLEIIAKAKSESLTLRESLEKEAREAADKIIS SAKISIANERRENLERLQSEAREAAYIAAEALMKKELSREDNDKLVDQFIKELENNEK
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links

KEGG: uur:UU135

STRING: 273119.UU135

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Ureaplasma parvum serovar 3 and why is it important in research?

Ureaplasma parvum serovar 3 is one of four serovars (1, 3, 6, and 14) belonging to the species U. parvum, which along with U. urealyticum (serovars 2, 4, 5 and 7-13) comprises the human Ureaplasma species . These organisms are among the smallest free-living, self-replicating cells, lacking cell walls and having limited biosynthetic functions . U. parvum serovar 3 has gained significant research attention due to its association with preterm births and its isolation from human placentas of preterm deliveries, as demonstrated with the OMC-P162 strain isolated at 26 weeks' gestation . Research importance stems from its pathogenic potential in urogenital infections, adverse pregnancy outcomes, and respiratory tract colonization in preterm infants, which is a significant risk factor for bronchopulmonary dysplasia (BPD) . The organism's unique biology, including its minimal genome and distinctive energy metabolism centered around urea hydrolysis, makes it an interesting model for studying bacterial adaptation and pathogenesis mechanisms .

What is the function of ATP synthase subunit b (atpF) in Ureaplasma parvum?

ATP synthase subunit b (atpF) is a critical component of the F0F1-ATP synthase complex in Ureaplasma parvum. This enzyme complex plays an essential role in the organism's bioenergetics, particularly given Ureaplasma's unique energy metabolism. Unlike most bacteria that use glucose metabolism for energy production, Ureaplasma generates ATP primarily through urea hydrolysis, creating a proton motive force across the membrane . The atpF subunit forms part of the membrane-embedded F0 portion of the ATP synthase, serving as a peripheral stalk that connects the F1 catalytic domain to the F0 proton channel. This architectural role is crucial for maintaining the structural integrity of the ATP synthase complex during the rotational catalysis that drives ATP synthesis. The subunit helps transmit conformational changes between the proton-translocating and catalytic domains, thus coupling proton flow to ATP production. In the minimal genome of Ureaplasma, the efficiency of this energy-generating system is particularly important for cellular survival and pathogenicity.

How does Ureaplasma parvum serovar 3 differ from other serovars genetically?

Genetic comparison of Ureaplasma parvum serovar 3 with other serovars reveals both conserved genomic regions and distinctive genetic elements. Comparative genome analysis of U. parvum serovars demonstrates that specific strains like OMC-P162 (serovar 3) contain unique genes not found in other serovar 3 strains . For instance, the OMC-P162 strain possesses ten unique genes, with five encoding hypothetical proteins . Notably, two genes, UPV_229 and UPV_230, form an operon that encodes a DNA methyltransferase and a restriction enzyme, respectively, constituting a type II restriction-modification system that is not present in all serovar 3 strains . The genomic differences extend to virulence factors as well, with variation in the multiple banded antigen (MBA) gene, which encodes an immunodominant surface protein that exhibits significant antigenic variation . These genetic differences contribute to variations in pathogenic potential among serovars and may explain the differential clinical outcomes observed in patients infected with different Ureaplasma strains. The genetic diversity within serovars is further complicated by evidence of horizontal gene transfer, resulting in hybrid genomes with serotype-specific markers from multiple serovars .

What recombinant expression systems have been successful for Ureaplasma parvum proteins?

Successful recombinant expression of Ureaplasma parvum proteins has been achieved primarily using Escherichia coli-based systems. The pTrcHis TOPO plasmid has been effectively employed for cloning and expressing the multiple banded antigen (MBA) genes from U. parvum serotypes 3 and 6 . Another successful approach utilized the pET28a(+) expression vector with NdeI and XhoI restriction sites for the expression of UPV_229 and UPV_230 proteins from U. parvum OMC-P162 strain . These E. coli expression systems provide high protein yields and are compatible with various purification strategies, including affinity chromatography using histidine tags. When expressing Ureaplasma proteins, researchers must address the genetic code variation where the UGA codon encodes tryptophan in Mycoplasma/Ureaplasma rather than serving as a stop codon as in the standard genetic code . This requires site-directed mutagenesis to convert TGA codons to TGG in the gene sequence before expression in E. coli, as demonstrated in the methodology for UPV_229 expression where overlap extension PCR was used to make these codon adjustments . The recombinant proteins produced using these systems have successfully maintained their biological activities, including enzymatic functions and antigenic properties, making them valuable tools for immunological and functional studies.

How can researchers overcome the genetic code variation in Ureaplasma when expressing recombinant proteins?

Overcoming the genetic code variation in Ureaplasma, particularly the use of UGA codons for tryptophan rather than as stop signals, requires strategic approaches for successful recombinant protein expression. The most effective method involves systematic site-directed mutagenesis to convert all TGA codons to TGG codons in the target gene before expression in heterologous systems like E. coli . This can be accomplished through overlap extension PCR using primers designed to introduce the necessary nucleotide changes. For example, when expressing the UPV_229 methyltransferase from U. parvum OMC-P162, researchers designed three sets of primers: outermost primers for full-length amplification (methyl-F1 and methyl-R1) and two sets of inner primers (methyl-F2/R2 and methyl-F3/R3) containing the TGA to TGG mutations . The PCR protocol involved multiple rounds: first generating fragments with the desired mutations, then using these fragments as templates in a second round with the outermost primers to create the full-length, mutation-containing gene . Alternative strategies include synthetic gene synthesis with optimized codons for the expression host, or using specialized Mycoplasma-derived expression systems that naturally recognize UGA as tryptophan. For multiple mutations, researchers should verify the integrity of the final construct through sequencing to ensure all intended changes are incorporated without introducing unwanted mutations. This approach has successfully produced functional Ureaplasma proteins while maintaining their native biological activities.

What are the critical factors in designing experiments to investigate the interaction between ATP synthase subunits in Ureaplasma parvum?

Investigating interactions between ATP synthase subunits in Ureaplasma parvum requires careful experimental design addressing several critical factors. First, protein purification conditions must maintain native protein conformations, typically requiring non-denaturing detergents like n-dodecyl β-D-maltoside or digitonin to solubilize membrane proteins while preserving protein-protein interactions. Second, researchers should consider complementary interaction detection methods including co-immunoprecipitation, yeast two-hybrid assays, and surface plasmon resonance to provide converging evidence. When designing constructs for interaction studies, domain preservation is essential; truncated proteins should retain complete functional domains to avoid false negatives. Additionally, researchers must address the genetic code variation in Ureaplasma, where UGA codons encode tryptophan rather than serving as stop codons in E. coli, through site-directed mutagenesis converting TGA to TGG codons . Tag placement requires careful consideration - tags should be positioned to minimize interference with interaction surfaces, potentially necessitating both N- and C-terminal tagged versions for comprehensive analysis. Finally, physiological relevance should be verified through crosslinking studies in intact Ureaplasma cells and functional complementation assays examining whether mutant phenotypes can be rescued by interacting proteins. An effective control strategy includes using known interacting subunits from the ATP synthase complex as positive controls and unrelated Ureaplasma proteins as negative controls.

How does the restriction-modification system in Ureaplasma parvum affect recombinant DNA experiments?

The restriction-modification systems in Ureaplasma parvum present significant challenges for recombinant DNA experiments involving this organism. The type II restriction-modification system identified in the OMC-P162 strain of U. parvum serovar 3, comprising the UPV_229 (methyltransferase) and UPV_230 (restriction endonuclease) genes, serves as a bacterial defense mechanism that recognizes and cleaves foreign DNA . The UPV_230 protein, designated UpaP162, recognizes the CATG sequence and creates a blunt cut between A and T . This activity directly impacts transformation efficiency when introducing recombinant constructs into Ureaplasma, as any unprotected CATG sites in the incoming DNA will be cleaved. Researchers can overcome this barrier through several approaches: (1) Pre-methylation of plasmids by expressing the UPV_229 methyltransferase in E. coli prior to Ureaplasma transformation, as studies have shown that methylation by UPV_229 completely blocks UpaP162 activity ; (2) Site-directed mutagenesis to eliminate CATG recognition sites from essential regions of vectors; (3) Temporary inhibition of the restriction system during transformation; or (4) Selection of U. parvum strains lacking active restriction systems, as research has shown variability in restriction enzyme expression among strains . Comparative analysis of restriction activity among different U. parvum isolates revealed that while some strains (F26, OMC-P162, S104, and S29) displayed similar restriction patterns, others showed different patterns or no detectable activity, offering potential alternative hosts for recombinant DNA experiments .

What are the best approaches for studying post-translational modifications of ATP synthase in Ureaplasma parvum?

Studying post-translational modifications (PTMs) of ATP synthase in Ureaplasma parvum requires a comprehensive analytical approach combining advanced proteomics with functional validation. Mass spectrometry-based techniques, particularly liquid chromatography-tandem mass spectrometry (LC-MS/MS), serve as the primary identification method, with enrichment strategies enhancing detection sensitivity for specific modifications. Phosphorylation analysis benefits from titanium dioxide or immobilized metal affinity chromatography enrichment, while glycosylation detection requires lectin affinity chromatography or hydrazide chemistry. Researchers should employ parallel reaction monitoring or multiple reaction monitoring for targeted quantification of modified peptides. Site-directed mutagenesis of putative modification sites allows functional validation through ATP synthesis activity assays comparing wild-type and mutant proteins. Comparative analysis between recombinant and native ATP synthase is crucial, as heterologous expression systems may lack the necessary modification machinery present in Ureaplasma. Time-course experiments can reveal modification dynamics under different conditions, while antibodies against specific PTMs enable visualization through immunoblotting. When analyzing complex membrane proteins like ATP synthase, researchers should consider both the catalytic F1 portion and the membrane-embedded F0 portion independently, as they may undergo different modifications. The experimental design should account for Ureaplasma's unique biology, including its dependence on urea metabolism for energy generation and the potential influence of pH changes on ATP synthase function and modification state.

How can researchers effectively investigate the role of ATP synthase in Ureaplasma parvum pathogenicity?

Investigating ATP synthase's role in Ureaplasma parvum pathogenicity requires multilevel approaches combining genetic manipulation, in vitro models, and clinical correlations. Researchers should begin with comparative genomic analysis of ATP synthase genes across clinical isolates with varied pathogenicity profiles, similar to approaches used for other virulence factors . Gene knockdown or knockout studies using antisense oligonucleotides or CRISPR interference (CRISPRi) can directly assess ATP synthase's contribution to survival and virulence, though these techniques must be adapted for Ureaplasma's genetic particularities. Specific inhibitors of ATP synthase activity enable pharmacological validation of genetic findings, while site-directed mutagenesis of key residues helps identify critical functional domains. In vitro infection models using human cell lines relevant to Ureaplasma infection sites (respiratory epithelial cells, placental trophoblasts) allow measurement of host responses including inflammatory cytokine production, cell death, and bacterial persistence when exposed to wild-type versus ATP synthase-modified strains. Advanced techniques such as RNA sequencing can reveal host transcriptional responses to ATP synthase-mediated effects. Researchers should also investigate potential surface exposure of ATP synthase components, as bacterial ATP synthases can sometimes function as adhesins. Animal models, particularly the preterm lamb BPD model, provide in vivo validation of in vitro findings . Finally, immunological studies measuring antibody responses to ATP synthase components in patient sera can indicate in vivo expression during infection and potential diagnostic value, similar to approaches used with MBA antigens .

What are the optimal PCR conditions for amplifying Ureaplasma parvum genes for recombinant expression?

Optimal PCR conditions for amplifying Ureaplasma parvum genes require careful optimization due to the organism's low G+C content (approximately 25-30%) and genetic code variations. For primer design, researchers should create oligonucleotides with a length of 20-30 nucleotides, incorporating appropriate restriction sites at the 5' ends with 3-4 additional nucleotides beyond the restriction site to facilitate efficient enzyme digestion . Given the A+T-rich genome, primers should ideally have a GC content of 35-45% with a melting temperature (Tm) of 45-55°C. The PCR reaction mixture should contain high-fidelity DNA polymerases such as Ex Taq (Takara Bio) to minimize amplification errors . A typical PCR protocol for Ureaplasma genes includes initial denaturation at 94°C for 2 minutes, followed by 30 cycles of denaturation at 94°C for 15 seconds, annealing at 45-50°C for 15 seconds (lower than standard due to A+T richness), and extension at 72°C for 1 minute per kb of target sequence, with a final extension at 72°C for 1-5 minutes . For genes containing TGA codons (which encode tryptophan in Ureaplasma but act as stop codons in standard genetic code), overlap extension PCR with multiple primer sets designed to mutate TGA to TGG codons is necessary, requiring two rounds of PCR as demonstrated in the UPV_229 gene amplification . Genomic DNA extraction should utilize specialized kits suitable for small genome bacteria, such as the Genomic DNA Buffer Set and QIAGEN Genomic-tip system . The addition of DMSO (2-5%) or betaine (1M) can improve amplification efficiency by reducing secondary structure formation in A+T-rich regions.

What purification strategies are most effective for recombinant Ureaplasma ATP synthase subunits?

Purification of recombinant Ureaplasma ATP synthase subunits requires a strategic approach addressing the membrane-associated nature of these proteins and their unique properties. For initial capture, affinity chromatography using histidine-tagged constructs has proven successful with Ureaplasma proteins expressed in E. coli systems, as demonstrated with the expression plasmids pTrcHis TOPO and pET28a(+) . Incorporating a TEV protease cleavage site between the tag and the protein allows tag removal while maintaining protein integrity. Due to the hydrophobic regions in ATP synthase subunits, particularly the b subunit (atpF), detergent selection is critical - mild non-ionic detergents like n-dodecyl β-D-maltoside (DDM) at 0.05-0.1% or digitonin at 0.5-1% effectively solubilize membrane proteins while preserving native conformations. Following affinity purification, size exclusion chromatography separates aggregates and provides information about the oligomeric state, while ion exchange chromatography removes contaminants with different charge properties. For functional studies requiring the assembled ATP synthase complex, co-expression of multiple subunits using polycistronic vectors may be necessary, followed by gentle extraction preserving subunit interactions. Protein quality assessment should include SDS-PAGE, Western blotting with subunit-specific antibodies, mass spectrometry for identity confirmation, and circular dichroism to verify proper folding. Optimization of buffer conditions is essential throughout the purification process, with stability generally enhanced by including 10-15% glycerol, 150-200 mM NaCl, and pH 7.5-8.0, which aligns with Ureaplasma's preference for slightly alkaline conditions related to its urease activity .

How can recombinant Ureaplasma proteins be used to develop serological assays for clinical applications?

Developing serological assays using recombinant Ureaplasma proteins requires strategic selection of immunodominant antigens and optimization of assay parameters for clinical diagnostics. The multiple banded antigen (MBA) has proven effective as a recombinant antigen for serological assays due to its surface exposure and immunogenicity . When developing such assays, researchers should express recombinant proteins in systems like pTrcHis TOPO plasmids, followed by affinity purification to ensure high purity . Enzyme-linked immunosorbent assay (ELISA) protocols using recombinant Ureaplasma proteins have demonstrated efficacy in detecting antibody responses in patient sera, with studies showing that 51% of sera from culture-positive women reacted with one or both recombinant MBA proteins from serotypes 3 and 6 . The specificity of such assays is critical, as cross-reactivity between serotypes can occur; for example, recombinant MBA from serotype 3 shows strong cross-reactions with antibodies from other U. parvum serotypes . To enhance specificity, researchers should consider using multiple recombinant proteins or specific immunodominant epitopes rather than whole proteins. Multiplex assays incorporating several serotype-specific antigens enable simultaneous detection of multiple serotypes in a single test. Validation requires testing with well-characterized panels of positive and negative control sera, with sensitivity and specificity calculations based on culture results as the gold standard. Western blotting can complement ELISA results by confirming antibody specificity to the correct-sized protein . For ATP synthase subunit b (atpF), researchers should first determine its immunogenicity and surface accessibility in Ureaplasma before development as a diagnostic antigen, as its utility may differ from established surface antigens like MBA. The ultimate clinical utility of serological assays depends on establishing clear correlations between antibody responses to specific recombinant proteins and clinical conditions, such as preterm birth risk or respiratory colonization in neonates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.