Recombinant Ureaplasma parvum serovar 3 ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Ureaplasma parvum serovar 3 ATP synthase subunit c (atpE) is a bacterial membrane protein critical for ATP synthesis. Produced via E. coli expression systems, this recombinant protein includes a full-length sequence (1-109 amino acids) fused to an N-terminal polyhistidine (His) tag for purification . The protein’s primary structure is conserved, with the amino acid sequence:
MSSFIDITNVISSHIEANLPAIASENVGSLANGAGIAYLGKYIGTGITMLAAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSILIIFVA .

ParameterDetails
UniProt IDB1AIC5 (Creative Biomart) ; Q9PR08 (Cusabio)
Expression SystemEscherichia coli
TagN-terminal His tag (6xHis for Creative Biomart; 10xHis for Cusabio)
Purity>85%–90% (SDS-PAGE)
FormLyophilized powder or liquid in Tris/PBS buffer with trehalose

Serological Assay Development

Recombinant atpE is used alongside other antigens (e.g., MBA) to develop serological tools for detecting U. parvum antibodies . For example, ELISA and Western blot assays with recombinant MBA proteins demonstrated cross-reactivity with monoclonal antibodies, highlighting potential diagnostic utility .

Pathogenicity Studies

Chronic U. parvum infections in animal models show that antigenic variation (e.g., MBA size polymorphisms) correlates with inflammation severity . While atpE is not a variable antigen, its role in ATP synthesis may indirectly influence bacterial persistence in hostile environments like the amniotic cavity .

Clinical and Biotechnological Relevance

  • Antibiotic Resistance Studies: Serovar 3 exhibits higher reinfection rates post-antibiotic therapy, suggesting resilience linked to metabolic adaptations .

  • Vaccine Development: Conserved proteins like atpE are potential targets for vaccines aimed at disrupting bacterial energy metabolism .

Challenges and Future Directions

Current limitations include the lack of structural data for atpE and its interactions with host cells. Future studies could leverage cryo-EM or X-ray crystallography to resolve its 3D architecture, aiding in drug design . Additionally, knockout models could clarify its role in U. parvum survival during infection .

Product Specs

Form
Lyophilized powder
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines. Shipping is standard with blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpE; UPA3_0142; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Target Names
atpE
Target Protein Sequence
MSSFIDITNVISSHIEANLPAIASENVGSLANGAGIAYLGKYIGTGITMLAAGAVGLMQG FSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSILIIFVA
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The ATP synthase subunit c is a key component of the F(0) channel, directly involved in transmembrane proton translocation. A homomeric c-ring, consisting of 10-14 subunits, forms the central stalk rotor element in conjunction with the F(1) delta and epsilon subunits.
Database Links
Protein Families
ATPase C chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit c (atpE) in Ureaplasma parvum serovar 3?

ATP synthase subunit c (atpE) in Ureaplasma parvum serovar 3 is a critical component of the F0 portion of ATP synthase that forms the membrane-embedded proton channel. This protein plays an essential role in energy metabolism by facilitating proton translocation across the membrane, which drives ATP synthesis. In U. parvum, which has a highly reduced genome (0.75-0.78 Mbp), the ATP synthase complex represents a crucial part of the limited metabolic machinery available to this organism . Unlike typical bacteria, Ureaplasma species lack cell walls and depend heavily on membrane proteins like atpE for maintaining cellular homeostasis. The atpE gene in U. parvum serovar 3 encodes a hydrophobic protein that oligomerizes to form the c-ring structure within the ATP synthase complex.

What techniques are used to identify and validate the atpE gene in U. parvum serovar 3?

Several molecular techniques can be employed to identify and validate the atpE gene in U. parvum serovar 3. PCR amplification using primers designed from conserved regions of the atpE gene represents the primary approach, similar to strategies used for amplifying other genes in Ureaplasma . Sanger sequencing of the amplified product confirms the gene identity and enables comparison with reference sequences. For more comprehensive analysis, whole genome sequencing approaches have been successfully applied to Ureaplasma, allowing identification of the atpE gene within its genomic context . Gene expression can be validated through RT-PCR and RNA-Seq techniques. Functional validation often involves recombinant expression followed by biochemical characterization. Additionally, transposon mutagenesis methods specifically adapted for Ureaplasma parvum can be used to disrupt the atpE gene and observe the resulting phenotypes, though this approach requires specialized transformation protocols due to the challenging nature of genetic manipulation in Ureaplasma species .

What are the optimal systems for recombinant expression of U. parvum serovar 3 atpE?

The optimal expression systems for recombinant U. parvum serovar 3 atpE must account for the protein's hydrophobic nature and potential toxicity to host cells. E. coli-based systems using specialized strains such as C41(DE3) or C43(DE3), which are engineered for membrane protein expression, tend to yield the best results. Expression vectors containing regulated promoters (T7, tac, or arabinose-inducible) allow controlled expression to minimize toxicity. The inclusion of fusion tags such as His6, MBP (maltose-binding protein), or SUMO can enhance solubility and facilitate purification. For challenging expressions, cell-free protein synthesis systems represent an alternative approach that bypasses cell viability concerns. When using bacterial expression systems, codon optimization of the atpE gene sequence for the host organism is essential due to the distinct codon usage bias in Ureaplasma compared to common expression hosts. Temperature modulation (typically lowering to 20-25°C) during induction and expression phases helps reduce inclusion body formation. The polyethylene glycol-based transformation protocols successfully used for other Ureaplasma genes could potentially be adapted for recombinant atpE expression in its native context .

What purification strategies yield the highest purity and stability for recombinant atpE?

Purification of recombinant atpE requires specific strategies optimized for membrane proteins. Initial extraction from bacterial membranes should utilize mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin, which effectively solubilize membrane proteins while preserving native structure. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins serves as an effective primary purification step. This should be followed by size exclusion chromatography to remove aggregates and achieve higher purity. Throughout the purification process, maintaining a stable detergent concentration above its critical micelle concentration in all buffers is crucial to prevent protein aggregation. The addition of lipids or lipid-like molecules (such as cholesterol hemisuccinate) to purification buffers can significantly enhance protein stability. For functional studies, reconstitution into nanodiscs or liposomes composed of synthetic lipids (POPC/POPG mixtures) provides a native-like membrane environment. Stability can be further enhanced by purifying at lower temperatures (4°C) and including glycerol (10-15%) in all buffers to prevent aggregation.

How can researchers overcome expression challenges specific to U. parvum membrane proteins?

Researchers can overcome expression challenges specific to U. parvum membrane proteins through several specialized approaches. Creating fusion constructs with highly soluble proteins like MBP or SUMO at the N-terminus significantly improves expression levels and solubility. When designing expression constructs, removing or modifying highly hydrophobic regions while preserving functional domains can reduce aggregation propensity. Screening multiple detergents at various concentrations during extraction and purification is essential—often, a combination of detergents yields better results than single detergents alone. Adapting cells to membrane protein expression by pre-inducing with low concentrations of inducer before full induction can improve yields. For particularly challenging constructs, directed evolution approaches can be employed to select for variants with improved expression characteristics. When standard bacterial systems fail, alternative expression platforms like yeast (P. pastoris), insect cells, or mammalian cells may prove more successful for maintaining protein folding and stability. Genetic modification techniques specifically developed for Ureaplasma, such as the Tn4001-based mini-transposon system with gentamicin resistance markers, can be adapted to manipulate atpE expression in its native context .

What structural features of atpE contribute to its function in U. parvum serovar 3?

The atpE protein in U. parvum serovar 3 contains key structural features essential for its function in ATP synthesis. The protein consists primarily of two transmembrane α-helices connected by a short polar loop, with the conserved carboxyl group-containing residue (typically aspartate or glutamate) located in the middle of the second helix. This carboxyl group is critical for proton binding and release during the rotational catalysis process. The hydrophobic residues that dominate both helices facilitate proper insertion into the membrane and stabilize the c-ring oligomer through helix-helix interactions. The c-subunit oligomerizes to form a ring structure (typically containing 8-15 subunits depending on the species) that rotates against the a-subunit during proton translocation. Given the minimal genome of U. parvum (0.75-0.78 Mbp), the atpE protein likely represents an evolutionarily optimized version that maintains essential functionality despite potential sequence divergence from other bacterial homologs . Specialized adaptations in the atpE structure may facilitate function within the unique energy metabolism pathways of Ureaplasma, which differs significantly from typical bacterial metabolism.

What biophysical techniques are most informative for analyzing recombinant U. parvum atpE structure?

Several biophysical techniques provide valuable information about recombinant U. parvum atpE structure at different resolution levels. Circular dichroism (CD) spectroscopy serves as a rapid method to confirm proper secondary structure folding, typically revealing the predominant α-helical content characteristic of atpE. Fourier-transform infrared spectroscopy (FTIR) can provide complementary secondary structure information, particularly for protein reconstituted in lipid environments. For higher resolution structural insights, solution NMR spectroscopy is particularly suitable for this relatively small membrane protein, especially when solubilized in detergent micelles or reconstituted into nanodiscs. Solid-state NMR represents an alternative approach for analyzing atpE in a lipid bilayer environment. Cryo-electron microscopy (cryo-EM) can visualize the entire ATP synthase complex, providing insights into how atpE integrates within the larger molecular machinery. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) reveals information about protein dynamics and accessibility of different regions. Molecular dynamics simulations, when based on homology models or experimental structures, can predict how the protein behaves in membrane environments and identify regions crucial for oligomerization. Cross-linking mass spectrometry provides valuable data on protein-protein interactions within the assembled c-ring structure.

How does the ATP synthase activity differ between U. parvum serovar 3 and other bacterial species?

ATP synthase activity in U. parvum serovar 3 exhibits distinct characteristics compared to other bacterial species, reflecting adaptations to its unique ecological niche and metabolic requirements. Unlike conventional bacteria that generate proton motive force through respiratory chains, U. parvum relies primarily on ATP hydrolysis by the F1 portion to power essential cellular processes. This reversed operation (ATP hydrolysis rather than synthesis) may be more prevalent in U. parvum, which obtains ATP through substrate-level phosphorylation during urea hydrolysis. The enzyme likely operates with different kinetic parameters optimized for the low-energy environment of this minimalist organism. The c-ring stoichiometry (number of c-subunits) might differ from other bacteria, which would affect the bioenergetic efficiency of the enzyme. Unlike respiratory bacteria, U. parvum lacks a conventional electron transport chain, suggesting that its ATP synthase may interact with alternative cellular components to maintain membrane potential. The ATP synthase complex may have evolved specific regulatory mechanisms adapted to the fluctuating urease activity that characterizes Ureaplasma metabolism . The complex might also exhibit different sensitivity to inhibitors compared to homologs from other species, which has implications for antimicrobial development.

How can recombinant atpE be utilized in studying U. parvum pathogenesis?

Recombinant atpE can serve as a valuable tool in investigating U. parvum pathogenesis through multiple experimental approaches. The protein can be used to generate specific antibodies for immunolocalization studies, enabling researchers to track the distribution of ATP synthase during host cell interactions and infection processes. Such antibodies can also serve in western blot analysis to monitor expression levels under different environmental conditions, similar to approaches used for other Ureaplasma proteins . As a membrane protein, recombinant atpE can be incorporated into artificial membrane systems to study its potential role in maintaining the proton gradient necessary for U. parvum survival in the changing pH environments encountered during infection. The protein might serve as a target for developing inhibitory compounds that could disrupt energy metabolism in U. parvum, particularly relevant given that this organism is associated with adverse pregnancy outcomes including preterm deliveries . Additionally, purified recombinant atpE can be used in binding studies to identify potential interactions with host cellular components, which may reveal unexpected roles in host-pathogen interactions beyond its canonical function in ATP synthesis.

What experimental models best demonstrate the functional significance of atpE in U. parvum?

Several experimental models effectively demonstrate the functional significance of atpE in U. parvum serovar 3. Cell-based infection models using human cell lines (particularly THP-1 monocytoid cells) allow investigation of atpE's role during host-pathogen interactions, similar to models used to study other aspects of Ureaplasma pathogenesis . Sheep models, which have been successfully employed for studying U. parvum infections in the context of pregnancy complications, provide physiologically relevant systems to examine atpE function in vivo . Genetic manipulation approaches, particularly transposon mutagenesis using Tn4001-based mini-transposon systems with gentamicin resistance markers, offer powerful tools to disrupt the atpE gene and observe resulting phenotypes . Reconstituted liposome systems incorporating purified atpE provide controlled environments to measure proton translocation activity and assess the effects of potential inhibitors. Comparative genomics approaches analyzing atpE conservation across clinical isolates from various infection sites can reveal selection pressures that might indicate functional importance in different host environments. Growth experiments in media containing ATP synthase inhibitors at sub-lethal concentrations can demonstrate the physiological importance of the protein for U. parvum survival and replication.

What role might atpE play in antibiotic resistance mechanisms in U. parvum?

The atpE protein may contribute to antibiotic resistance mechanisms in U. parvum through several potential pathways. As a component of ATP synthase, atpE influences the maintenance of membrane potential, which affects the uptake efficiency of many antibiotics, particularly aminoglycosides and other charged antimicrobial compounds. Mutations in the atpE gene could potentially alter the conformation of the c-ring structure, affecting the binding of certain antibiotics that target ATP synthase directly. The interplay between ATP synthase activity and the expression of antimicrobial peptides by host cells might represent another resistance mechanism, as U. parvum has been shown to suppress host antimicrobial peptide expression . Under antibiotic stress, U. parvum may modulate atpE expression or activity to adjust energy metabolism, potentially entering a low-energy state that reduces susceptibility to antibiotics targeting active replication. ATP synthase inhibition can trigger compensatory mechanisms that upregulate other resistance determinants, creating cross-resistance phenomena. The restriction-modification systems identified in some U. parvum strains, such as type II restriction-modification system in strain OMC-P162, may interact with energy metabolism pathways involving ATP synthase to regulate responses to antimicrobial stresses . Additionally, biofilm formation, which often correlates with increased antibiotic resistance, may depend on energy metabolism processes mediated by ATP synthase.

What evolutionary insights can be gained from studying U. parvum atpE compared to other Mollicutes?

Studying U. parvum atpE in comparison with other Mollicutes provides significant evolutionary insights into minimal cellular systems. The retention of functional ATP synthase components including atpE in the highly reduced genome of U. parvum (0.75-0.78 Mbp) indicates strong selective pressure to maintain this machinery despite extensive genome reduction during evolution . Phylogenetic analysis of atpE sequences across Mollicutes can help reconstruct evolutionary relationships and identify convergent adaptations to similar ecological niches. Comparative analysis of the c-ring stoichiometry (number of c-subunits) between U. parvum and other Mollicutes may reveal adaptive shifts in bioenergetic efficiency related to different host environments. The presence of horizontal gene transfer affecting atpE, potentially more common in U. urealyticum than U. parvum, contributes to understanding genetic exchange dynamics within this bacterial class . Variation in ATP synthase composition across Mollicutes, from complete complexes to partial complexes or complete loss, illustrates different evolutionary strategies for energy metabolism in minimal cells. The comparison of codon usage patterns in atpE across Mollicutes can provide insights into translational optimization during genome reduction. Analysis of selective pressures (dN/dS ratios) on atpE sequences across different Mollicutes species can identify regions under purifying selection versus those allowing more variation.

How do post-translational modifications of atpE differ between laboratory-expressed recombinant protein and native U. parvum protein?

Post-translational modifications (PTMs) of atpE can differ significantly between laboratory-expressed recombinant protein and native U. parvum protein due to several factors. The recombinant expression systems (typically E. coli) lack many of the specific modification enzymes present in U. parvum, potentially resulting in absence of native modifications such as methylation or acetylation patterns. Mass spectrometry analysis reveals that native atpE may undergo modifications influenced by the unique intracellular environment of Ureaplasma, including exposure to high urea concentrations and ammonia that could promote carbamylation of lysine residues. Heterologous expression might introduce non-native modifications specific to the host organism, creating artifacts not present in the native protein. The lipid environment differs substantially between recombinant expression systems and U. parvum membranes, potentially affecting lipid-protein interactions that influence protein conformation and modification accessibility. Native atpE likely experiences dynamic modification patterns in response to environmental conditions encountered during infection, which are difficult to replicate in laboratory expression systems. Certain recombinant expression strategies, particularly those using fusion tags that require protease cleavage, may leave non-native amino acid residues that can alter protein properties. Advanced proteomics approaches combining enrichment strategies with high-resolution mass spectrometry are required to fully characterize the PTM landscape of native atpE.

How might atpE contribute to U. parvum adaptation to different host microenvironments?

The atpE protein likely plays a crucial role in U. parvum adaptation to diverse host microenvironments through several sophisticated mechanisms. As part of the ATP synthase complex, atpE contributes to maintaining proper intracellular pH homeostasis, allowing the organism to colonize host niches with varying pH conditions, from the typically acidic vaginal environment to the more neutral amniotic fluid environment encountered during intrauterine infections . The efficiency of proton translocation through the c-ring formed by atpE subunits directly influences energy conservation, enabling metabolic adjustments necessary when transitioning between nutritionally distinct host environments. U. parvum strains isolated from different clinical sites (placenta, amniotic fluid, vaginal samples) may exhibit subtle variations in atpE sequence or expression levels that optimize function for each specific niche . The protein's function likely intersects with the organism's ability to suppress host antimicrobial peptide expression, a documented virulence mechanism that facilitates persistent colonization across diverse host tissues . ATP synthase activity modulated by atpE could influence the expression of virulence factors such as the multiple banded antigen (MBA), which demonstrates size variation correlated with inflammation severity . The ability of U. parvum to persist in chronic infections may partially depend on energy conservation strategies mediated by optimal ATP synthase function in nutrient-limited environments.

What novel inhibitors could specifically target U. parvum atpE with minimal effects on host ATP synthase?

Developing novel inhibitors that specifically target U. parvum atpE while sparing host ATP synthase requires exploiting structural and functional differences between bacterial and eukaryotic enzymes. Computational drug design approaches utilizing homology models of U. parvum atpE can identify unique binding pockets absent in human ATP synthase. Natural products, particularly those derived from fungi that compete with bacteria in similar ecological niches, offer promising starting points for U. parvum-specific ATP synthase inhibitors. Peptide-based inhibitors designed to disrupt the c-ring assembly process represent another avenue, as the oligomerization interfaces likely differ between U. parvum and human ATP synthase. Structure-activity relationship studies focusing on derivatives of known ATP synthase inhibitors (such as oligomycin or venturicidin) can optimize selectivity for the bacterial enzyme. Allosteric inhibitors targeting non-conserved regions of the c-subunit might achieve specificity without affecting the catalytic mechanism shared with host enzymes. The unique metabolic context of U. parvum, which relies on urea hydrolysis, suggests that designed inhibitors could capitalize on synergistic effects with the organism's urease activity. High-throughput screening of compound libraries against purified recombinant atpE reconstituted in liposomes, coupled with counter-screening against human ATP synthase, can identify lead compounds with the desired selectivity profile.

How can CRISPR-Cas9 or similar genome editing technologies be optimized for studying atpE function in Ureaplasma?

Optimizing CRISPR-Cas9 or similar genome editing technologies for studying atpE function in Ureaplasma presents significant challenges that require specialized adaptations. Development of Ureaplasma-specific delivery systems is crucial, potentially utilizing the polyethylene glycol-based transformation protocols that have previously succeeded in transforming U. parvum with Tn4001-based mini-transposon plasmids . Designing compact CRISPR systems is essential due to the limited capacity for foreign DNA in organisms with minimal genomes, possibly employing miniaturized Cas9 variants or Cas12a systems with smaller coding sequences. Custom promoters derived from U. parvum endogenous regulatory elements must drive expression of Cas9 and guide RNAs to ensure sufficient expression levels in this unique genetic background. Guide RNA design should account for the high A+T content of the Ureaplasma genome to ensure specificity and efficiency. For targeting essential genes like atpE, inducible or partial knockdown approaches using CRISPRi are preferable to complete knockouts, which could be lethal. Homology-directed repair templates must be carefully designed with sufficient homology arms while considering the limited homologous recombination efficiency in Ureaplasma. Screening strategies utilizing the gentamicin resistance selection marker, which has been successful in previous Ureaplasma genetic manipulations, can identify successful editing events . Selection systems based on metabolic markers rather than antibiotics might reduce stress on cells during the editing process, potentially improving efficiency.

What are the optimal conditions for enzymatic activity assays of recombinant U. parvum atpE?

Enzymatic activity assays for recombinant U. parvum atpE require carefully optimized conditions that mimic the protein's native environment. For proton translocation measurements, reconstitution of purified atpE into liposomes composed of synthetic lipids (typically POPC:POPG mixtures at 3:1 ratio) provides a suitable membrane environment. The buffer system should maintain pH stability while allowing detection of proton movement, with 20 mM HEPES-KOH (pH 7.0-7.5) being optimal for initial assays. Inclusion of pH-sensitive fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine enables real-time monitoring of proton flux across the membrane. ATP synthase activity measurements should include physiologically relevant concentrations of substrates: 2-5 mM ATP, 2-5 mM MgCl₂, and 50-100 mM KCl. Temperature control at 37°C matches the physiological temperature of the human host environment. When studying the complete ATP synthase complex, inclusion of the proton ionophore FCCP at the end of experiments provides a control for maximum proton gradient dissipation. For competitive inhibition studies, preincubation of the reconstituted protein with potential inhibitors for 10-15 minutes before initiating the reaction ensures binding equilibrium. Continuous assay formats utilizing coupled enzyme systems (such as pyruvate kinase and lactate dehydrogenase with NADH oxidation detection) provide sensitive measurement of ATP hydrolysis activity.

What protocols ensure reproducible results when comparing atpE function across different U. parvum clinical isolates?

Ensuring reproducible results when comparing atpE function across different U. parvum clinical isolates requires standardized protocols at every experimental stage. Isolation and culture conditions must be strictly controlled, using identical media compositions and growth phases for harvesting cells, similar to protocols used in studies comparing different Ureaplasma strains . Genomic DNA extraction should follow consistent methodologies, with quality and purity verification via spectrophotometric analysis (A260/A280 ratios) and gel electrophoresis. PCR amplification of the atpE gene requires validated primers targeting conserved flanking regions, with standardized thermocycling conditions and polymerase selections. When constructing expression vectors, identical promoters, fusion tags, and cloning sites should be used for all isolates to eliminate expression system variables. Protein expression conditions, including induction parameters (inducer concentration, temperature, duration) must be kept constant across all samples. Purification protocols should employ identical column types, buffer compositions, and elution gradients, with thorough documentation of purification yields and purity levels via SDS-PAGE and western blotting . Functional assays must utilize consistent protein concentrations, substrate levels, and detection methods, with multiple technical and biological replicates to ensure statistical validity. When possible, performing parallel experiments with all isolates simultaneously eliminates day-to-day variables. Comprehensive data collection and standardized analysis methods, including consistent normalization procedures, ensure valid comparisons between different isolates.

How can researchers effectively combine structural biology and molecular dynamics to understand atpE function?

Researchers can effectively combine structural biology and molecular dynamics to develop a comprehensive understanding of atpE function through an integrated workflow. The process should begin with obtaining experimental structural data, preferably through solution NMR spectroscopy of detergent-solubilized atpE or solid-state NMR of the protein in lipid bilayers. X-ray crystallography of the entire ATP synthase complex can provide complementary structural context. These experimental structures serve as starting points for building refined molecular models, incorporating information about oligomeric assembly of the c-ring. For molecular dynamics (MD) simulations, the protein should be embedded in lipid bilayer compositions mimicking the Ureaplasma membrane environment, using force fields optimized for membrane proteins (such as CHARMM36 or AMBER lipid17). Long-timescale simulations (microsecond range) capture conformational dynamics relevant to proton translocation. Constant pH molecular dynamics simulations are particularly valuable for investigating protonation/deprotonation events central to atpE function. Enhanced sampling techniques like metadynamics or umbrella sampling help characterize energy barriers for proton transfer and c-ring rotation. Simulation results should be validated against experimental observables whenever possible, such as chemical shift data from NMR or distance constraints from cross-linking experiments. Computational mutagenesis studies can predict the effects of natural variations observed in clinical isolates or design experimental mutations to test mechanistic hypotheses. Integration of coarse-grained simulations with atomistic models allows exploration of larger-scale phenomena like c-ring assembly and interaction with other ATP synthase components.

What statistical approaches are most appropriate for analyzing atpE sequence variations among clinical isolates?

The statistical analysis of atpE sequence variations among clinical isolates requires methodologies that account for the unique evolutionary and epidemiological characteristics of Ureaplasma parvum. Sequence alignment and phylogenetic analysis should employ maximum likelihood or Bayesian methods to construct robust evolutionary relationships among isolates, similar to approaches used for analyzing MBA gene variations . Population genetics statistics including nucleotide diversity (π), Tajima's D, and Fu and Li's F* can identify signatures of selection acting on the atpE gene. For detecting associations between specific sequence variants and clinical outcomes, logistic regression models incorporating potential confounding variables should be employed. When analyzing larger datasets from multiple clinical sources, hierarchical clustering approaches can identify patterns of sequence variation that might correlate with anatomical sites or disease states. Comparative analysis of synonymous versus non-synonymous substitution rates (dN/dS) provides insights into selective pressures acting on different protein regions. For detecting recombination events that might affect atpE evolution, methods such as RDP4 or GARD are appropriate. Principal component analysis (PCA) or discriminant analysis of principal components (DAPC) can visualize population structure among isolates based on sequence variation. For validation, bootstrapping and permutation tests should be employed to assess the robustness of identified associations and phylogenetic relationships.

How should researchers integrate transcriptomic, proteomic, and functional data to understand atpE regulation?

Researchers should adopt a multi-layered integration approach to synthesize transcriptomic, proteomic, and functional data for understanding atpE regulation in U. parvum. Initial correlation analysis between atpE transcript levels (measured by RNA-Seq or qRT-PCR) and protein abundance (determined by targeted proteomics) can identify potential post-transcriptional regulatory mechanisms. Time-course experiments measuring both transcript and protein levels under varying conditions (pH shifts, nutrient limitations, antibiotic exposure) help construct temporal regulation models. Network analysis incorporating co-expressed genes and interacting proteins can place atpE regulation within broader cellular response pathways. Functional data from ATP synthase activity assays should be mathematically modeled in relation to transcript and protein levels to establish quantitative relationships between expression and enzymatic function. Pathway enrichment analysis of differentially expressed genes under conditions affecting atpE expression can identify regulatory circuits that control energy metabolism. The integration of epigenetic data, particularly DNA methylation patterns identified through techniques similar to those used in other Ureaplasma studies , may reveal additional regulatory mechanisms. Statistical approaches like partial least squares regression or canonical correlation analysis can formally quantify relationships between transcriptomic, proteomic, and functional datasets. Causal inference methods such as Granger causality or dynamic Bayesian networks help establish temporal and regulatory relationships between multiple datasets. Machine learning approaches, particularly supervised methods like random forests or support vector machines, can identify patterns and predictive features across integrated datasets.

What are the key considerations when interpreting contradictory results from different experimental systems?

When interpreting contradictory results from different experimental systems studying U. parvum atpE, researchers should systematically evaluate several critical factors. The physiological relevance of each experimental system must be assessed—results from native U. parvum cells generally carry more biological relevance than heterologous expression systems, though they may be more challenging to interpret due to complex cellular interactions. Differences in protein structure or post-translational modifications between recombinant and native atpE may explain functional discrepancies, necessitating thorough biochemical characterization of proteins from each system. Experimental conditions, particularly pH, temperature, and ionic strength, should be carefully compared, as ATP synthase activity is highly sensitive to these parameters. The presence of fusion tags or non-native amino acids in recombinant constructs might alter protein behavior, requiring validation with tag-free proteins or multiple tag positions. Sensitivity and resolution differences between detection methods can create apparent contradictions when measuring the same phenomenon. When comparing results across different U. parvum strains, genomic differences beyond the atpE sequence itself might contribute to functional variations, similar to observations with restriction-modification systems . Statistical analysis should account for variability intrinsic to different experimental systems, potentially requiring normalization procedures or meta-analysis approaches. Ultimately, complementary approaches that combine in vitro biochemical data with cellular and in vivo observations, similar to methodology used in studies of MBA variation , provide the most robust interpretations of seemingly contradictory results.

What are the primary technical challenges in studying U. parvum atpE and how can they be overcome?

The study of U. parvum atpE faces several significant technical challenges that require innovative solutions. The fastidious growth requirements of Ureaplasma make obtaining sufficient biomass for protein purification difficult; this can be addressed by developing enhanced culture media formulations or establishing continuous culture systems. The hydrophobic nature of atpE complicates expression and purification, necessitating specialized approaches such as fusion with solubility-enhancing tags and careful detergent selection. Genetic manipulation of Ureaplasma remains challenging despite some success with transposon mutagenesis systems ; further refinement of transformation protocols specific to U. parvum using polyethylene glycol enhancement methods could improve genetic accessibility. The small genome and minimalist metabolism of U. parvum complicates metabolic studies because perturbation of ATP synthase function may have broader effects than in organisms with redundant pathways. This challenge requires development of more sensitive metabolomic approaches to detect subtle changes. The association between in vitro findings and clinical relevance needs stronger connections, potentially through development of improved animal models that better recapitulate human urogenital infections. Low protein abundance of native atpE necessitates highly sensitive detection methods; advances in targeted proteomics using selected reaction monitoring (SRM) could address this limitation. Finally, the lack of structural information specific to U. parvum ATP synthase components hinders structure-based studies, making investment in structural biology approaches for this organism a priority for future research.

How might future research on atpE contribute to understanding U. parvum pathogenesis?

Future research on atpE has significant potential to enhance our understanding of U. parvum pathogenesis through several avenues of investigation. Development of conditional mutants affecting atpE expression could reveal how energy metabolism influences virulence factor expression, particularly the multiple banded antigen (MBA) that correlates with inflammation severity . Investigation of how ATP synthase function affects the organism's ability to suppress host antimicrobial peptide expression—a documented virulence mechanism—could uncover new pathogenesis pathways . Studies examining atpE sequence polymorphisms in clinical isolates from different infection sites (vaginal, placental, amniotic, respiratory) might identify adaptive variations associated with tissue tropism or disease severity. Research into how atpE contributes to the organism's persistence in chronic infections could identify mechanisms of bacterial dormancy or stress response during antibiotic treatment. Development of atpE-specific inhibitors would enable controlled manipulation of U. parvum energy metabolism in experimental systems, allowing precise dissection of metabolic contributions to pathogenicity. Investigation of potential interactions between ATP synthase components and host cellular factors could reveal unexpected roles in host-pathogen interactions. Long-term evolutionary studies examining atpE sequence conservation across clinical isolates collected over time may identify signatures of adaptation to changing host environments or antibiotic pressures. Integration of these findings with wider systems biology approaches will position atpE within the broader network of factors contributing to U. parvum pathogenesis.

What emerging technologies hold the most promise for advancing U. parvum atpE research?

Several emerging technologies show exceptional promise for advancing U. parvum atpE research in the coming years. Cryo-electron tomography can visualize ATP synthase complexes directly within Ureaplasma cells, providing structural insights in the native cellular context without isolation artifacts. Single-molecule techniques, including magnetic tweezers or FRET-based approaches, could measure mechanical rotation and conformational changes of the ATP synthase in real-time, providing unprecedented functional details. Advanced genome editing technologies, particularly CRISPR interference (CRISPRi) adapted for minimal genomes, offer possibilities for targeted gene regulation without complete disruption of essential genes like atpE. Microfluidic cultivation systems could revolutionize Ureaplasma growth capabilities, allowing precise control of environmental conditions and continuous monitoring of metabolic responses. Nanobody development against specific conformational states of atpE could provide tools for both structural stabilization and functional modulation. Integrative structural biology approaches combining multiple techniques (NMR, cryo-EM, cross-linking mass spectrometry) could resolve the complete structure of U. parvum ATP synthase. Single-cell techniques including Raman microscopy could measure ATP synthase activity in individual bacteria during host cell interactions. Organ-on-chip technologies incorporating human urogenital tract tissues could provide physiologically relevant models for studying atpE function during infection. Advanced computational approaches, particularly machine learning algorithms trained on protein-protein interactions, could predict novel binding partners for atpE that might reveal unexpected functions beyond ATP synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.