Recombinant Ureaplasma parvum serovar 3 Putative phosphotransferase enzyme IIB component UU178 (UU178)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UU178; Putative phosphotransferase enzyme IIB component UU178; Putative PTS system EIIB component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
UU178
Target Protein Sequence
MQNLNNKQKTLIIFLGIITFGIFIIYFFTKAKKVSQIRNTHLIVSSNIPFSLNDFYNCIG SKNNLVNVDATINTLKIELKEINALNNEKLKVLGAKGIMCNQTKISIIFGDFCLELKELI KKDLFS
Uniprot No.

Target Background

Function

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a primary carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concurrently with their translocation across the cell membrane.

Database Links

KEGG: uur:UU178

STRING: 273119.UU178

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UU178 and what is its role in Ureaplasma parvum?

UU178 (Q9PQW5) is a putative phosphotransferase enzyme IIB component found in Ureaplasma parvum serovar 3. It is classified as part of the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), which is involved in sugar transport and phosphorylation in bacteria. The protein consists of 126 amino acids and functions as a component in the bacterial carbohydrate uptake pathway . Although classified as a putative PTS system EIIB component, it is also sometimes annotated as a "hypothetical protein," indicating that its precise function has not been fully characterized experimentally . Some sources alternatively associate it with DNA mismatch repair protein MutT function, suggesting potential multifunctional properties that warrant further investigation .

How is recombinant UU178 typically produced and purified?

Recombinant UU178 is commonly produced in E. coli expression systems. The most frequently employed methodology involves cloning the UU178 gene into a pTrcHis TOPO plasmid or similar vector that incorporates an N-terminal His-tag to facilitate purification . The expression construct typically includes the full-length sequence (amino acids 1-126) of UU178 .

The purification process generally follows these steps:

  • Bacterial cell lysis under native or denaturing conditions

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Size exclusion chromatography for further purification

  • Quality assessment by SDS-PAGE with typical purity levels exceeding 85-90%

The final product is often provided in a lyophilized form or in a storage buffer containing Tris/PBS and stabilizers such as trehalose (6%) at pH 8.0 .

What are the recommended storage conditions for recombinant UU178?

For optimal stability and activity of recombinant UU178, the following storage conditions are recommended:

  • Long-term storage: -20°C to -80°C in aliquots to minimize freeze-thaw cycles

  • Working aliquots: 4°C for up to one week

  • Buffer composition: Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Reconstitution: If received as lyophilized powder, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol (5-50% final concentration) before aliquoting

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and activity .

What experimental approaches are optimal for validating the functional activity of recombinant UU178?

Validating the functional activity of recombinant UU178 requires multiple complementary approaches:

  • Phosphotransferase activity assay: As UU178 is putatively involved in phosphate transfer, assessing its ability to transfer phosphate groups using radioactively labeled substrates or coupled enzyme assays can provide direct evidence of its functionality.

  • Binding assays: Since UU178 is a putative EIIB component, evaluating its interaction with other PTS components (EIIA, EIIC) through co-immunoprecipitation, yeast two-hybrid, or surface plasmon resonance can validate its biological role.

  • Complementation studies: Introducing recombinant UU178 into bacterial strains with PTS deficiencies to assess functional restoration.

  • Structural integrity verification: Circular dichroism spectroscopy to confirm proper protein folding, which is essential for activity assessment.

  • Antibody reactivity: Testing recombinant UU178 with serotype-specific antibodies can help verify epitope preservation, similar to approaches used for other Ureaplasma antigens like MBA, where monoclonal antibodies have been effective in validating recombinant protein authenticity .

When designing validation experiments, it is essential to include positive controls (known functional PTS components) and negative controls (heat-inactivated protein or buffer alone) to accurately interpret results.

How can recombinant UU178 be effectively incorporated into immunological studies?

For incorporating recombinant UU178 into immunological studies, researchers should consider:

  • Antigen preparation: Ensure optimal protein concentration (typically 1-10 μg/mL for ELISA) with minimal buffer interference. The high purity (>90%) of commercially available recombinant UU178 makes it suitable for immunological applications without further processing .

  • Immunization protocols: When raising antibodies against UU178, consider using the purified protein with appropriate adjuvants. Based on experiences with other Ureaplasma antigens, a prime-boost protocol with at least three immunizations separated by 2-3 weeks typically yields optimal antibody responses .

  • ELISA development: When establishing ELISA protocols with recombinant UU178, coat plates with 50-100 ng of protein per well and include appropriate blocking steps to minimize background. The methodology used for MBA antigens of Ureaplasma can serve as a template, where recombinant proteins have successfully detected serotype-specific antibody responses .

  • Western blotting: Recombinant UU178 can be detected effectively in Western blotting using anti-histidine antibodies, confirming the expected molecular mass based on the protein sequence plus the His-tag (approximately 15-16 kDa) .

  • Cross-reactivity assessment: As observed with other Ureaplasma antigens, cross-reactivity between serotypes can occur. Therefore, include controls with antibodies against various Ureaplasma serotypes to determine specificity, as demonstrated in studies with MBA where significant cross-reactions occurred between different serotypes .

What considerations should be taken when designing experiments to study UU178's role in Ureaplasma pathogenicity?

When investigating UU178's potential role in Ureaplasma pathogenicity, consider these critical design elements:

  • Clinical isolate diversity: Include multiple clinical isolates representing different patient populations and disease states, as pathogenicity may vary across strains despite similar UU178 expression. Studies of other Ureaplasma antigens have shown that pathogenicity is likely multifactorial and not solely serotype-specific .

  • Expression analysis: Quantify UU178 expression levels across different growth conditions and in clinical isolates from various sources using qRT-PCR and Western blotting to correlate expression with virulence.

  • Mutagenesis studies: Generate UU178 knockout or knockdown strains to assess changes in bacterial fitness, host cell adherence, and invasion capabilities.

  • Host-pathogen interaction models: Establish appropriate in vitro models (e.g., respiratory or urogenital epithelial cell cultures) and in vivo models to assess UU178's contribution to colonization and pathogenesis.

  • Immune response characterization: Evaluate host immune responses to UU178 by measuring antibody production and cytokine profiles in infected host cells or animal models.

  • Comparative analysis: Compare results with other Ureaplasma serotypes and species to determine if UU178's role in pathogenicity is conserved or variable across the genus. Research has shown that adverse pregnancy outcomes associated with Ureaplasma infection may involve an ascending infection from the lower genital tract, and the etiology is likely multifactorial .

  • Patient serology: Assess antibody responses against UU178 in patient populations with and without Ureaplasma-associated conditions to determine its relevance in clinical settings. Previous studies have shown that 51% of sera from culture-positive women reacted with recombinant Ureaplasma antigens, compared to only 15% of sera from culture-negative women .

How does UU178 compare to other Ureaplasma antigens like MBA for research applications?

Comparing UU178 to the multiple banded antigen (MBA), which has been more extensively studied in Ureaplasma research:

FeatureUU178MBA
ExpressionConstitutive expression as a metabolic enzymeSurface-exposed lipoprotein with variable expression
Antigenic variationRelatively conserved within serotypesHigh variation due to tandem repeats; contains both serotype-specific and non-serotype-specific epitopes
Size126 amino acids (~15 kDa plus tag) Variable (30-170 kDa) depending on number of repeats
ImmunogenicityLimited data on human antibody responsesWell-documented immune response; principal antigen recognized by human antibodies
ApplicationsMetabolic studies, potential diagnostic targetSerotyping, vaccine development, diagnostic assays
Cross-reactivityUnknown, requires further characterizationStrong cross-reactions observed between different serotypes
Recombinant productionSuccessful expression in E. coli with His-tag Successfully produced in E. coli; MBA of serotype 3 yields larger product (~1,500 bp) than serotype 6 (~400 bp)

For research applications, MBA has been more extensively characterized and shown value in serological assays, with 51% of sera from culture-positive women reacting with recombinant MBA . UU178's research utility is likely more focused on understanding Ureaplasma metabolism and potentially developing novel antimicrobial targets rather than diagnostics or serotyping.

What are the challenges in optimizing protein refolding to ensure proper conformation of recombinant UU178?

Optimizing protein refolding for recombinant UU178 presents several challenges:

  • Membrane protein characteristics: The amino acid sequence of UU178 suggests it may have membrane-associated domains, which often present refolding difficulties due to hydrophobic regions .

  • Buffer optimization: The standard storage buffer containing Tris/PBS with 6% trehalose at pH 8.0 provides a starting point, but systematic screening of buffers with various additives (detergents, glycerol, arginine) may be necessary to identify optimal refolding conditions .

  • Redox environment: Controlling the redox environment during refolding is crucial, especially if UU178 contains disulfide bonds. A glutathione redox system (GSH/GSSG) at various ratios should be tested to optimize disulfide bond formation.

  • Step-wise dialysis: Implementing a gradual dialysis protocol to remove denaturants can improve refolding efficiency. Starting with high denaturant concentrations (6-8M urea or guanidine-HCl) and gradually reducing them over multiple steps (typically 4-6 steps) can prevent aggregation.

  • Temperature considerations: Performing refolding at lower temperatures (4°C) often reduces aggregation and improves yield of correctly folded protein.

  • Functional validation: After refolding, functional assays should verify that the refolded UU178 retains its biological activity. Since UU178 is a putative phosphotransferase enzyme, enzymatic activity assays specific to this class of proteins would be appropriate.

  • Structural verification: Techniques such as circular dichroism, tryptophan fluorescence, and limited proteolysis can provide evidence of proper folding before proceeding to more complex functional studies.

What controls should be included when using UU178 in experimental settings?

When conducting experiments with recombinant UU178, the following controls are essential:

  • Positive controls:

    • Purified native UU178 (if available) to compare activity with recombinant protein

    • Known functional phosphotransferase proteins from related bacterial species

    • Anti-His antibodies for detection validation in immunoassays

  • Negative controls:

    • Heat-denatured UU178 to confirm specificity of activity-based assays

    • Empty vector-transformed E. coli lysates processed through the same purification steps

    • Buffer-only conditions for baseline measurements

  • Specificity controls:

    • Recombinant proteins from other Ureaplasma serotypes to assess cross-reactivity

    • Other PTS system components to evaluate system-specific interactions

    • Monoclonal antibodies against different Ureaplasma serotypes to determine antibody specificity patterns similar to those observed with MBA antigens

  • Technical controls:

    • Serial dilutions of UU178 to establish dose-response relationships

    • Time-course experiments to determine optimal incubation periods

    • Storage time controls to assess stability under recommended conditions

Including these controls will enhance data interpretation and ensure experimental validity when working with recombinant UU178.

What are the best methods for assessing protein-protein interactions involving UU178?

To investigate protein-protein interactions involving UU178, consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using anti-His antibodies to pull down His-tagged UU178 and identify interacting partners by mass spectrometry. This approach requires careful optimization of buffer conditions to maintain native interactions.

  • Bacterial two-hybrid system: More suitable than yeast two-hybrid for bacterial proteins, this system can identify potential interacting partners of UU178 within the PTS system or other metabolic pathways.

  • Surface Plasmon Resonance (SPR): Quantitative measurement of binding kinetics between UU178 and potential partners. The His-tagged UU178 can be immobilized on a sensor chip, allowing real-time monitoring of interactions.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can capture transient interactions that might be missed by other methods.

  • Microscale Thermophoresis (MST): This technique measures the directed movement of molecules in microscopic temperature gradients and is suitable for determining binding affinities with minimal protein consumption.

  • Native PAGE: Non-denaturing gel electrophoresis can preserve protein complexes and identify shifts in migration patterns when UU178 forms complexes with partner proteins.

  • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of binding interactions between UU178 and its partners, offering insights into the energetics of complex formation.

When implementing these methods, it is critical to ensure that the recombinant UU178 retains its native conformation, as improper folding can lead to false-negative results in interaction studies.

How can researchers effectively compare experimental results across different recombinant UU178 preparations?

To ensure valid comparisons across different recombinant UU178 preparations, researchers should implement these standardization practices:

  • Protein quantification standardization: Use multiple protein quantification methods (BCA, Bradford, and absorbance at 280 nm) to establish reliable concentration measurements, as single methods may be affected by buffer components.

  • Purity assessment: Standardize SDS-PAGE analysis with densitometry to accurately determine protein purity, which should consistently exceed 90% for comparable preparations .

  • Functional validation: Establish a standardized activity assay specific to phosphotransferase function and use it to normalize different preparations based on specific activity rather than total protein.

  • Batch documentation: Maintain detailed records of expression conditions, purification protocols, and storage history for each preparation, including E. coli strain used, induction parameters, and purification yields .

  • Reference standards: Create a well-characterized reference batch of UU178 against which all new preparations are compared using established physicochemical and functional parameters.

  • Stability profiling: Perform accelerated stability studies to determine degradation rates and establish comparable "effective ages" of different preparations.

  • Structural verification: Use circular dichroism or other structural analysis techniques to verify consistent secondary structure composition across batches.

  • Endotoxin testing: Standardize endotoxin removal procedures and implement consistent testing to ensure preparations have comparable endotoxin levels, especially important for immunological studies.

By implementing these standardization practices, researchers can minimize batch-to-batch variability and ensure that experimental differences reflect biological phenomena rather than preparation artifacts.

How can recombinant UU178 contribute to the development of diagnostic tools for Ureaplasma infections?

Recombinant UU178 holds potential for diagnostic applications through several avenues:

  • Serological assays: Development of ELISA-based tests using purified recombinant UU178 could help detect antibody responses in patients with suspected Ureaplasma infections. Similar approaches with other Ureaplasma antigens have shown that recombinant proteins can effectively detect serotype-specific antibody responses, with 51% of sera from culture-positive women showing reactivity .

  • Multiplex antigen panels: Combining UU178 with other Ureaplasma antigens like MBA in multiplexed assays could increase diagnostic sensitivity and specificity while potentially differentiating between serotypes.

  • Point-of-care testing: Incorporating UU178 into rapid immunochromatographic tests could enable quick detection of Ureaplasma infections in clinical settings, particularly valuable for maternal-fetal medicine where timely intervention may prevent adverse pregnancy outcomes.

  • PCR standards: Recombinant UU178 plasmid constructs could serve as positive controls and quantification standards for molecular diagnostic assays targeting Ureaplasma.

  • Biosensor development: Immobilized UU178 on biosensor platforms could enable rapid, automated detection of anti-Ureaplasma antibodies in patient samples.

Future research should focus on determining the sensitivity and specificity of UU178-based diagnostics compared to current gold standards, and whether UU178 detection correlates with clinical manifestations of Ureaplasma infections.

What are the emerging research directions for understanding UU178's role in Ureaplasma biology?

Emerging research directions for UU178 include:

  • Metabolic network mapping: Using systems biology approaches to position UU178 within the broader metabolic network of Ureaplasma, which has a reduced genome and unique metabolic adaptations as a host-associated microorganism.

  • Antimicrobial target validation: Investigating UU178's potential as a novel antimicrobial target, given that PTS components are absent in human cells and often essential for bacterial metabolism.

  • Structural biology: Determining the three-dimensional structure of UU178 through X-ray crystallography or cryo-EM to understand its functional mechanisms and facilitate structure-based drug design.

  • Host-pathogen interaction: Exploring whether UU178 plays a role in host-pathogen interactions beyond its metabolic function, potentially contributing to colonization or immune evasion.

  • Comparative genomics: Analyzing UU178 sequence conservation and variation across Ureaplasma isolates from different clinical sources to determine if specific variants correlate with virulence or tissue tropism.

  • Transcriptional regulation: Investigating the regulation of UU178 expression under different environmental conditions that mimic the host environment during colonization and infection.

  • Post-translational modifications: Characterizing potential post-translational modifications of UU178 that may regulate its activity or localization within the bacterial cell.

Advancing these research directions will require interdisciplinary approaches and may benefit from the established methodologies used in studying other Ureaplasma antigens like MBA, where recombinant protein technology has already yielded valuable insights .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.