Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU007 (UU007)

Shipped with Ice Packs
In Stock

Description

General Information

The article focuses on Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU007 (UU007). Ureaplasma parvum (UPA) and Ureaplasma urealyticum (UUR) are sexually transmitted bacteria found in humans and are implicated in disease states such as nongonococcal urethritis, infertility, adverse pregnancy outcomes, chorioamnionitis, and bronchopulmonary dysplasia in neonates . There are 4 serotypes of UPA and 10 distinct serotypes of UUR .

Genetic Characterization

In U. parvum serovar 3, two loci (‘mba locus’ and ‘UU172 phase-variable element’) undergo high-frequency phase variation via site-specific DNA inversions at short inverted repeats . Phase variation between UU375 (GenBank: AAF30784.1) (mba for multiple banded antigen) and UU376 (GenBank: AAF30785.1) (upvmp for Ureaplasma phase-variable membrane protein) is thought to result from site-specific DNA recombination at the inverted repeats 5′-ATTTGAATTATCAAACAGAAAAAG-3′, which occurs when the ORFs are oriented in opposite directions .

Protein Interactions

Three potential tyrosine recombinases (RipX, XerC, and CodV encoded by the genes UU145, UU222, and UU529) have been annotated in the genome of U. parvum serovar 3, which could mediate the proposed recombination event. In vitro binding of recombinant maltose-binding protein fusions of XerC to the inverted repeats of the phase-variable loci, of RipX to a direct repeat that flanks a 20-kbp region, which has been proposed as putative pathogenicity island, and of CodV to a putative dif site has been documented .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UU007; Uncharacterized protein UU007
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
UU007
Target Protein Sequence
MLNILNNVSNSSLYSAASNATAQTGSNLINDLVPETLTASGISIAISVFSVIGTIVIALS VLPQTIKTLREKDTASLSLLLFLLNGIATAFLTLYGIGLVTVHPNSFSFLVDIKNGMFIY NREEWVAGYLICGIFLIMGEALCSVTSFIVLFCKVNNMIKAKKMGMSEEEYYEKQIKPFL KVKGAN
Uniprot No.

Target Background

Database Links

KEGG: uur:UU007

STRING: 273119.UU007

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Ureaplasma parvum serovar 3 and what is the significance of studying its proteins?

Ureaplasma parvum serovar 3 represents one of the predominant colonizers of the urogenital tract and is significantly associated with sexually transmitted pathogen coinfection (p < 0.01) . This microorganism has emerged as particularly significant in reproductive health research due to its association with female infertility and HPV infection . The study of its proteins, including the uncharacterized UU007 protein, is essential for understanding its pathogenicity mechanisms, antigenic variation capabilities, and potential role in host immune evasion. Research has demonstrated that U. parvum employs site-specific recombination events that lead to a broad spectrum of antigenic variation, which may contribute to its ability to evade host immune responses .

How does UU007 relate to other characterized proteins in Ureaplasma parvum serovar 3?

UU007 is one of several uncharacterized proteins identified in the genome of U. parvum serovar 3. While its specific function remains undetermined, it should be considered within the broader context of this microorganism's protein repertoire. In U. parvum serovar 3, the multiple banded antigen (MBA) has been well-characterized as a major surface membrane protein that undergoes phase variation with its counterpart, the UU376 protein, through DNA inversion at specific inverted repeats . Other characterized proteins include UU171, UU172, and UU144, which have been implicated in phase variation mechanisms . Understanding the potential relationship between UU007 and these better-characterized proteins may provide insights into its function within the organism's biology.

What are the optimal expression systems for producing recombinant UU007 protein?

Based on successful approaches with other Ureaplasma proteins, the optimal expression of recombinant UU007 typically involves:

  • Expression Vector Selection: The pTrcHis TOPO plasmid system has been demonstrated effective for MBA protein expression from U. parvum serovars and may be suitable for UU007 .

  • Host Selection: E. coli-based expression systems (typically BL21 derivatives) have shown success with Ureaplasma proteins.

  • Expression Conditions: Induction with IPTG at concentrations between 0.5-1.0 mM when cultures reach OD600 of 0.6-0.8, followed by expression at 30°C rather than 37°C to enhance protein solubility.

  • Protein Tags: N-terminal His-tags have been successfully applied to UU007 (186 amino acids), facilitating purification while maintaining protein functionality .

For optimal results, researchers should consider comparing multiple expression systems and conditions, as the unique characteristics of UU007 may require specific optimization protocols beyond those used for other Ureaplasma proteins.

What purification strategies yield the highest purity of functional UU007 protein?

A sequential purification strategy typically yields the best results:

  • Immobilized Metal Affinity Chromatography (IMAC): Using Ni-NTA or cobalt-based resins for initial capture of His-tagged UU007 protein.

  • Secondary Purification: Size exclusion chromatography to separate monomeric from aggregated forms and remove any remaining contaminants.

  • Buffer Optimization: Testing various buffer conditions (pH 7.0-8.0) with stabilizing agents (glycerol 5-10%, reducing agents like DTT or β-mercaptoethanol) to maintain protein stability and solubility.

Purification StepMethodBuffer CompositionExpected Purity
CaptureNi-NTA IMAC50mM Tris-HCl pH 8.0, 300mM NaCl, 10-250mM imidazole gradient60-80%
PolishingSize Exclusion20mM Tris-HCl pH 7.5, 150mM NaCl, 1mM DTT, 5% glycerol>95%

These purification strategies should be validated through SDS-PAGE, Western blotting with anti-His antibodies, and when specific antibodies are available, immunoreactivity testing with UU007-specific antibodies.

How can UU007 protein be used to develop serological assays for Ureaplasma detection?

Development of UU007-based serological assays requires:

  • Antigen Optimization: Determining optimal coating concentrations through checkerboard titration, similar to established protocols for MBA proteins (typically 1.25-2.5 μg/ml) .

  • Assay Format Selection: ELISA provides good sensitivity and specificity for Ureaplasma protein detection. Protocols include:

    • Coating plates with purified UU007 protein in carbonate/bicarbonate buffer (pH 9.6)

    • Blocking with 3% bovine serum albumin in PBS

    • Optimizing antibody dilutions to minimize background while maintaining sensitivity

    • Developing with appropriate detection systems (HRP-labeled secondary antibodies)

  • Validation: Testing with characterized monoclonal antibodies and human sera panels to establish sensitivity, specificity, and cross-reactivity profiles.

When developing such assays, researchers should consider that pure recombinant antigens offer advantages over whole-cell antigenic preparations, including standardized methods, stability, and absence of medium component contamination .

What approaches are recommended for investigating UU007's potential role in pathogenicity?

Investigating UU007's potential pathogenic role requires multiple complementary approaches:

  • Gene Expression Analysis: Quantifying UU007 expression levels in clinical isolates with varying pathogenicity profiles using RT-qPCR or RNA-seq.

  • Knockout/Knockdown Studies: Developing genetic manipulation systems to create UU007-deficient strains and assessing phenotypic changes in:

    • Adherence to epithelial cells

    • Biofilm formation capacity

    • Survival in human serum

    • Resistance to antimicrobial peptides

  • Immunological Studies: Assessing how UU007 interacts with components of the human immune system:

    • Neutrophil activation assays

    • Cytokine induction in peripheral blood mononuclear cells

    • Complement activation studies

  • Structural Biology Approaches: Determining UU007's structure to identify potential functional domains, which may suggest pathogenicity mechanisms.

These experimental approaches should be integrated to build a comprehensive understanding of UU007's potential role in U. parvum serovar 3 pathogenicity.

How can researchers overcome the challenges of working with a poorly characterized protein like UU007?

Working with uncharacterized proteins presents several challenges that can be addressed through:

  • Bioinformatic Analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction using algorithms like AlphaFold

    • Identification of conserved domains and motifs that might suggest function

    • Analysis of genomic context to identify potential operons or functional relationships

  • Functional Genomics Approaches:

    • Transcriptomic profiling to identify conditions that regulate UU007 expression

    • Co-expression analysis to identify proteins with similar expression patterns

    • Protein-protein interaction studies using pull-down assays or yeast two-hybrid screens

  • Comparative Analysis Across Ureaplasma Species:

    • Identifying whether UU007 homologs exist in other Ureaplasma species/serovars

    • Comparing expression patterns in pathogenic versus non-pathogenic strains

  • Antibody Development:

    • Generating specific antibodies against UU007 for localization studies

    • Using these antibodies to perform immunoprecipitation followed by mass spectrometry to identify binding partners

These approaches provide a framework for progressively building knowledge about UU007's function and significance.

What are the most reliable detection methods for Ureaplasma parvum serovar 3 in clinical and research samples?

Current optimal detection methods include:

  • Molecular Methods:

    • Real-time PCR targeting the ureC gene offers rapid, sensitive, and specific identification of U. urealyticum and U. parvum

    • PCR assays can detect as few as 10^2-10^3 bacteria/ml in clinical samples

    • Specimen requirements include EDTA whole blood (1 mL preferred), with stability for up to 7 days when refrigerated

  • Serological Methods:

    • ELISA using recombinant MBA proteins has shown promising results for U. parvum detection

    • Western blotting with serotype-specific monoclonal antibodies can provide serotype differentiation

  • Quantitative Considerations:

    • Bacterial load determination is crucial, as U. parvum loads >10^4 bacteria/ml are considered suggestive of active infection rather than colonization

    • This threshold has been particularly relevant in women with idiopathic infertility and asymptomatic HPV-infected women

Researchers should note that interpretation of positive results requires clinical correlation, as U. parvum may be part of the normal microbiota in some individuals .

How does UU007 protein research relate to the clinical importance of Ureaplasma parvum serovar 3 infections?

Understanding UU007's role may contribute to addressing several clinical challenges:

  • Colonization vs. Infection Differentiation: Research suggests U. parvum serovar 3 can exist as both a colonizer and pathogen, with bacterial loads >10^4 bacteria/ml indicating active infection . Determining whether UU007 expression correlates with this transition could provide valuable diagnostic markers.

  • Association with Reproductive Health Issues: U. parvum serovar 3 has been detected in 16% of follicular fluid from women with idiopathic infertility . Investigating UU007's potential role in reproductive tract persistence or pathology may provide insights into these associations.

  • Co-infection Dynamics: U. parvum serovar 3 is significantly associated with sexually transmitted pathogen coinfection . Research into whether UU007 facilitates these polymicrobial interactions could inform clinical approaches to complex infections.

  • Targeted Therapy Development: Recent studies have highlighted that women with U. parvum serovar 3 infections "may have the benefit of targeted therapy" . Understanding UU007's functional role could potentially contribute to developing such targeted approaches.

This research connects fundamental protein characterization to clinically relevant outcomes in reproductive and sexual health.

What experimental models are most appropriate for studying UU007 protein function in the context of human infection?

The most appropriate experimental models include:

  • Cell Culture Models:

    • Human urogenital epithelial cell lines (HeLa, VK2/E6E7, End1/E6E7)

    • Primary human endometrial or fallopian tube epithelial cells

    • Co-culture systems incorporating immune cells (macrophages, neutrophils)

  • Ex Vivo Tissue Models:

    • Human fallopian tube or endometrial explants

    • Reconstructed human vaginal epithelium

    • Organ-on-chip technologies mimicking the female reproductive tract

  • Animal Models:

    • Murine models of female reproductive tract infection

    • Non-human primate models for studying chronic colonization and long-term effects

Model TypeAdvantagesLimitationsBest Applications
Cell cultureControlled conditions, human cell types, ease of manipulationLacks tissue architecture, immune interactionsInitial host-pathogen interactions, mechanistic studies
Ex vivo tissueMaintains tissue architecture, includes multiple cell typesLimited viability period, variability between samplesTissue-specific responses, short-term infection dynamics
Animal modelsAllows for in vivo dynamics, immune responses, long-term studiesSpecies differences, ethical considerationsPathogenesis studies, therapeutic testing

When selecting models, researchers should consider the specific aspect of UU007 function being investigated and choose the most relevant system, often employing multiple complementary approaches for comprehensive understanding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.