Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU008 (UU008)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
UU008; Uncharacterized protein UU008
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
UU008
Target Protein Sequence
MNFTSLLQDGIYEVGNGAIVTDQSPYLGITPDYQGAYGFPTHPWGIFFQVVGAILVFGAY LPAVIKVLISKRTENLAIGMWIISIAGLGLLAIFAWLGVSVNPGGFILVALSETLSCIAS IIVFALKIANKAKAKAAGMTELEYCNLHYPIVKKLPKR
Uniprot No.

Target Background

Database Links

KEGG: uur:UU008

STRING: 273119.UU008

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Ureaplasma parvum serovar 3 and how does it relate to the UU008 protein?

Ureaplasma parvum is one of two recognized Ureaplasma species (alongside U. urealyticum) and encompasses serotypes 1, 3, 6, and 14. U. parvum serovar 3 is a specific strain within this species . Ureaplasma bacteria colonize the human urogenital tract and are present in 40-80% of sexually mature individuals as commensals . UU008 (designated as an uncharacterized protein) is encoded within the genome of U. parvum serovar 3, though its precise function remains to be fully elucidated .

The relationship between U. parvum serovar 3 and UU008 is particularly relevant for researchers investigating the molecular basis of Ureaplasma pathogenicity. While Ureaplasma is often commensal, it has been associated with adverse pregnancy outcomes and various infections including nongonococcal urethritis, chorioamnionitis, and neonatal pneumonia in certain clinical contexts .

What expression systems are utilized for recombinant UU008 production?

The predominant expression system for recombinant UU008 production is Escherichia coli. As evidenced in the available data, UU008 has been successfully expressed as a His-tagged recombinant protein with the full-length sequence (amino acids 1-158) . The use of E. coli as an expression host offers several methodological advantages:

  • Scalable production with relatively simple culture requirements

  • Established protocols for induction and purification

  • Compatibility with common vector systems (such as pTrcHis TOPO plasmid)

  • Ability to produce sufficient quantities for immunological studies

When establishing expression systems for UU008, researchers should consider optimization of codon usage for bacterial expression and purification strategies compatible with downstream applications.

What analytical methods are recommended for validating recombinant UU008 identity and purity?

For rigorous validation of recombinant UU008, researchers should employ a multi-modal approach:

  • SDS-PAGE analysis: To confirm the expected molecular weight and assess purity

  • Western blotting: Using serotype-specific monoclonal antibodies to confirm identity

  • Mass spectrometry: For precise molecular weight determination and sequence verification

  • ELISA: To evaluate functional immunoreactivity with serotype-specific antibodies

When validating recombinant UU008, researchers should be mindful of potential cross-reactivity with antibodies directed against other Ureaplasma serotypes. Studies with recombinant Multiple Banded Antigens (MBAs) have demonstrated both serotype-specific reactions and cross-reactivity between certain serotypes in immunological assays .

How can recombinant UU008 be utilized in serological assays for Ureaplasma detection?

Recombinant UU008 can serve as a valuable tool for developing serological assays to detect Ureaplasma antibodies. The methodological approach involves:

  • ELISA development: Coating plates with purified recombinant UU008 as the capture antigen

  • Standardization: Establishing appropriate concentrations and buffer conditions

  • Validation: Testing with serotype-specific monoclonal antibodies and patient sera

  • Clinical correlation: Comparing serological results with culture-based detection methods

Previous studies with recombinant Multiple Banded Antigens (MBAs) from U. parvum serotypes 3 and 6 demonstrated that 51% of sera from culture-positive women reacted with one or both recombinant antigens in ELISA, while only 15% of sera from culture-negative women showed reactivity . This suggests recombinant Ureaplasma proteins have potential utility in serological assays, and similar approaches could be applied with UU008.

What experimental strategies should be employed to investigate the functional properties of UU008?

Given the uncharacterized nature of UU008, a systematic approach to functional characterization should include:

  • Bioinformatic analysis: Sequence comparison, domain prediction, and structural modeling

  • Protein-protein interaction studies: Co-immunoprecipitation, pull-down assays, and yeast two-hybrid screening

  • Cellular localization: Immunofluorescence microscopy with tagged UU008 constructs

  • Gene knockout/knockdown: CRISPR-Cas9 or antisense approaches in Ureaplasma (technically challenging)

  • Heterologous expression: Expression in model organisms to assess phenotypic effects

For interaction studies, researchers should consider potential partners based on genomic context and preliminary observations of UU008 behavior in experimental systems.

What is known about potential horizontal gene transfer affecting UU008 expression and function?

Horizontal gene transfer (HGT) is a significant phenomenon in Ureaplasma evolution that may impact UU008 expression and function. Researchers investigating this aspect should note:

  • Extensive HGT has been documented among Ureaplasma species and serovars

  • Genome analysis has revealed recombinases, transposases, and putative conjugative transposon mobilization proteins in Ureaplasma genomes

  • Ureaplasma species can form biofilms, which may facilitate DNA exchange

When studying UU008 across different clinical isolates, researchers should be prepared to encounter genetic variations resulting from HGT events. Comparative genomic approaches can help identify conserved versus variable regions of UU008 that might influence protein function or immunogenicity.

How can researchers differentiate between serotype-specific and cross-reactive immune responses to UU008?

Differentiating serotype-specific from cross-reactive immune responses requires carefully designed experimental approaches:

  • Absorption studies: Pre-absorbing sera with heterologous serotypes to remove cross-reactive antibodies

  • Epitope mapping: Identifying serotype-specific versus shared epitopes on UU008

  • Competitive binding assays: Using purified proteins or peptides from different serotypes

  • Monoclonal antibody panels: Testing with serotype-specific and broadly reactive antibodies

Studies with recombinant MBAs have shown that prominent reactions occur with homologous monoclonal antibodies, while cross-reactions can also be observed between certain serotypes. For example, strong cross-reactions were detected between rMBA 3 and monoclonal antibodies from other U. parvum serotypes, with a weak cross-reaction with serotype 4 antibody. Conversely, rMBA 6 showed cross-reaction only with the monoclonal antibody from U. parvum serotype 1 .

Recombinant AntigenReaction with Homologous AntibodyCross-reaction with Other Serotypes
rMBA 3Strong positiveStrong with other U. parvum serotypes; Weak with serotype 4
rMBA 6Strong positiveOnly with U. parvum serotype 1

Similar methodological approaches should be applied when investigating UU008 cross-reactivity.

What PCR-based approaches are recommended for detection and quantification of the UU008 gene?

For accurate detection and quantification of the UU008 gene, researchers should implement:

  • Real-time quantitative PCR (qPCR): Using primers specific to the UU008 coding sequence

  • Species-specific primers: Designing primers that differentiate between U. parvum and U. urealyticum

  • Serovar-specific amplification: Including primers that distinguish serovar 3 from other U. parvum serovars

  • Multiplex PCR: Combining UU008 detection with markers for other Ureaplasma genes

Recent advances have enabled reliable differentiation of Ureaplasma species and serovars. As demonstrated in a study of 1,061 clinical isolates, real-time qPCR assays targeting species-specific and serovar-specific sequences allow for precise typing of clinical samples . Similar approaches could be adapted specifically for UU008 detection and quantification.

What cloning strategies are optimal for recombinant UU008 production?

Based on successful approaches with other Ureaplasma proteins, the following cloning strategy is recommended for UU008:

  • PCR amplification: Using specific primers designed to amplify the complete UU008 coding sequence

  • Vector selection: pTrcHis TOPO or similar expression vectors with affinity tags

  • Transformation: Into competent E. coli strains optimized for recombinant protein expression

  • Induction conditions: Optimization of IPTG concentration, temperature, and duration

  • Purification: Metal-affinity chromatography for His-tagged constructs

Similar methodologies have been successfully employed for producing recombinant MBAs from U. parvum serotypes 3 and 6, where genes were amplified by PCR and cloned into a pTrcHis TOPO plasmid . The resulting recombinant proteins were purified and effectively used in immunological assays.

What are the key challenges in characterizing UU008 function in the context of Ureaplasma pathogenicity?

Researchers investigating UU008's potential role in pathogenicity face several methodological challenges:

  • Genetic manipulation limitations: Ureaplasma is difficult to genetically modify due to its minimalist genome

  • Culture complexity: Specialized media requirements and slow growth of Ureaplasma

  • Multiple strain involvement: Clinical samples often contain multiple Ureaplasma strains or serovars

  • Horizontal gene transfer: Genomic instability and recombination between strains

  • Host immune response variability: Differences in antibody responses between individuals

These challenges necessitate multifaceted approaches combining genetic analysis, protein biochemistry, and clinical correlations. Researchers should consider how UU008 might contribute to known pathogenic mechanisms of Ureaplasma, such as adherence to host cells, immune evasion, or inflammatory response induction.

How should researchers design experiments to investigate potential interactions between UU008 and the host immune system?

To elucidate interactions between UU008 and host immunity, experiments should be designed to address:

  • Humoral immunity: Measuring antibody responses to UU008 in different patient populations

  • Cellular immunity: Assessing T-cell responses and cytokine profiles following UU008 stimulation

  • Innate immunity: Investigating interactions with pattern recognition receptors and complement

  • Epitope mapping: Identifying immunodominant regions within UU008

  • Cross-reactivity analysis: Evaluating antibody specificity across different Ureaplasma serotypes

Previous studies with recombinant Ureaplasma antigens found that 51% of sera from culture-positive women reacted with recombinant antigens, while only 15% of sera from culture-negative women showed reactivity . Similar serological approaches could be applied specifically to UU008 to assess its immunogenicity in different clinical contexts.

What genomic approaches could further elucidate the evolutionary history and functional significance of UU008?

Advanced genomic investigations of UU008 should incorporate:

  • Comparative genomics: Analyzing UU008 sequence conservation across Ureaplasma isolates

  • Population genetics: Studying UU008 polymorphisms in clinical samples

  • Transcriptomic analysis: Measuring UU008 expression under different conditions

  • Metagenomics: Identifying UU008 variants in the human microbiome

  • Phylogenetic analysis: Reconstructing the evolutionary history of UU008

These approaches can address whether UU008 exhibits the extensive horizontal gene transfer documented in other Ureaplasma genes. Genome analysis has revealed that Ureaplasma isolates often show evidence of genomic rearrangements, deletions, and insertions that affect target areas for serotype-specific detection . Similar phenomena may influence UU008 structure and function across different clinical isolates.

How might UU008 contribute to the differential pathogenicity observed between Ureaplasma strains?

Investigating UU008's potential role in differential pathogenicity should focus on:

  • Correlation studies: Comparing UU008 sequence variants with clinical outcomes

  • Functional assays: Measuring adhesion, invasion, or inflammatory responses with recombinant UU008

  • Animal models: Testing recombinant UU008 effects in appropriate infection models

  • Clinical isolate characterization: Comparing UU008 expression in isolates from symptomatic versus asymptomatic individuals

These approaches could help determine whether UU008 contributes to the long-standing question of differential pathogenicity among Ureaplasma strains. Studies have yielded inconsistent results regarding whether specific Ureaplasma species or serovars are more strongly associated with disease , suggesting complex pathogenicity mechanisms that may involve proteins like UU008.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.