Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU041 (UU041)

Shipped with Ice Packs
In Stock

Description

Overview of Ureaplasma parvum

Ureaplasma parvum (UPA) is a sexually transmitted bacterium implicated in disease states including infertility, nongonococcal urethritis, adverse pregnancy outcomes, chorioamnionitis, and bronchopulmonary dysplasia in neonates . There are four serovars of U. parvum . Determining the pathogenic potential at the ureaplasma serovar level has been difficult due to the limitations of antibody-based typing methods, multiple cross-reactions, and poor discriminating capacity in clinical samples containing multiple serovars .

General Information on UU041

The Ureaplasma parvum serovar 3 Uncharacterized protein UU041 (UU041) is a protein present in Ureaplasma parvum serovar 3. It is currently labeled as an uncharacterized protein, meaning its specific function and role within the organism are not yet fully understood. Research is ongoing to elucidate its properties and potential functions.

Genetic Context and Location

The gene encoding UU041 is located within the genome of U. parvum serovar 3. Comparative genome analysis of different Ureaplasma strains reveals genetic variations that may contribute to differences in their pathogenic potential .

Research on Tyrosine Recombinases in U. parvum serovar 3

Research has documented the presence of tyrosine recombinases (RipX, XerC, and CodV encoded by the genes UU145, UU222, and UU529) in the genome of U. parvum serovar 3, which could be mediators in the proposed recombination event . In vitro binding of recombinant maltose-binding protein fusions of XerC to the inverted repeats of the phase-variable loci, of RipX to a direct repeat that flanks a 20-kbp region, which has been proposed as putative pathogenicity island, and of CodV to a putative dif site has been demonstrated .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UU041; Uncharacterized protein UU041
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
UU041
Target Protein Sequence
MSSLPVIILVIGIFGSIFLVIGYIPQVIKVIKTKRTDGISLTFLISLNIACFLFVIYSIL VMIFNKHNGIPTALPLCLANTIVGILGLVILIYKVKNIKKAKLYLMDEKTYYEKYVLNNL
Uniprot No.

Target Background

Database Links

KEGG: uur:UU041

STRING: 273119.UU041

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.