Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU046 (UU046)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
UU046; Uncharacterized protein UU046
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-791
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
UU046
Target Protein Sequence
MKFIKRKTKLLTITIGAVAVSSILLGGIFYGTSQKSPSSFGIASIDQKENFINKDNLDYQ KARPSIKDNNLKEIPKPKPQPKPEPQPTPFPDPIPTPPKKEELKKPEIKPEEPKKPEIKP EPIPKPKPQPIPQPTPPVETKPKEELLPPSPPPPKEEPKPEPDPQPQPQQIPNQSTVRKI ELNGVLVDAEVEVPPPRQTFKYDQDNGLSNLNPYTNISVGKIKKVFVTDELRHKSADLVR GNLKRGDYQSLVKDLLDPNIKPEEIDSYIAMVDKSGYHAKLWSKFKKLFDTDNVVNFLNE QGKKEYPNMKTKFVSDAHKYAWLYAHLDFSKFTKLSANSEKYLQEGLTPDPDNSYVNENG ELDSYAYSPAKEYNTVTSRLANDNANRRVFGYNEWYNRSPNGLANGDYPGWNKSDATAEF KQYGIKDGDGIKVYKLERQKPQEGKLNTGYIVDIDADNPDGYQKTKELIQKLNNQNKKIT GYRIRNMGKSDSGQKFSDILKALPNELPLLELFFSAGSHNTSALSALETKHIKELGLYTL GNSLLDEWSINPNALRKVEWINSNDYNVSSEYKQGSDIATRITFDTLSFDKNDFNDNAND LRTKLKRINDGLRMVYWTRNNEPFFQGGFGPGLDPDHKEVGNSYPQGLDFSRVPQIRSLR GLIFKDEQKASNNRERKLRRVNFFNDKENYEMSINDLNEAGFSEHIVTNEPMPPKSKITF SNGNATKRIYIKGNGSLTASGIQNLATLFNLAESLDSKSVVVDSNNSELKSQLEGLGYKV SDASDANYIDI
Uniprot No.

Target Background

Database Links

KEGG: uur:UU046

STRING: 273119.UU046

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Ureaplasma parvum serovar 3 Uncharacterized protein UU046?

Ureaplasma parvum serovar 3 uncharacterized protein UU046 (UU046) is a full-length protein (791 amino acids) identified in the genome of Ureaplasma parvum serovar 3, but whose biological function remains largely unknown . The protein has been assigned the UniProt identifier Q9PR99 and represents one of several proteins in Ureaplasma parvum whose functions have yet to be fully characterized. Unlike well-studied surface proteins such as the multiple banded antigen (MBA), UU046 has not been extensively investigated for its role in pathogenicity or bacterial physiology.

The protein likely contributes to the unique biology of Ureaplasma parvum, a microorganism associated with various urogenital infections and potential complications including chorioamnionitis in pregnant women and bronchopulmonary dysplasia in newborn infants . As research continues to explore the molecular mechanisms of Ureaplasma pathogenicity, proteins like UU046 represent important targets for further characterization.

How is recombinant UU046 protein expressed and purified?

Recombinant UU046 protein is typically expressed in E. coli expression systems using appropriate expression vectors . Based on standard recombinant protein production methodology for Ureaplasma proteins:

  • The UU046 gene is amplified by PCR from Ureaplasma parvum serovar 3 genomic DNA.

  • The amplified gene is cloned into an expression vector (such as pTrcHis TOPO) that provides an N-terminal His-tag .

  • The recombinant vector is transformed into a suitable E. coli strain for protein expression.

  • Expression is induced under optimized conditions (temperature, induction time, IPTG concentration).

  • Cells are harvested and lysed to release the recombinant protein.

  • The His-tagged UU046 protein is purified using nickel affinity chromatography.

  • Additional purification steps (size-exclusion chromatography, ion-exchange chromatography) may be performed to achieve >90% purity .

The purified protein is typically obtained in a lyophilized powder form with greater than 90% purity as determined by SDS-PAGE .

What are the optimal storage conditions for recombinant UU046 protein?

For optimal stability and activity of recombinant UU046 protein, the following storage conditions are recommended:

  • Long-term storage: Store at -20°C or preferably -80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Storage buffer: The protein is typically stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability .

  • Reconstitution: Prior to use, the vial should be briefly centrifuged to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended before aliquoting for long-term storage .

  • Stability considerations: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

What is the potential role of UU046 in Ureaplasma parvum pathogenicity?

While the specific function of UU046 remains uncharacterized, we can hypothesize about its potential role in pathogenicity based on knowledge of Ureaplasma parvum biology:

  • Possible surface protein role: The protein sequence of UU046 contains regions that may be consistent with membrane localization, suggesting it could potentially function as a surface-exposed protein involved in host-pathogen interactions.

  • Relation to phase variation: Ureaplasma parvum serovar 3 exhibits phase variation at specific genomic loci, which contributes to immune evasion and adaptation to host environments . While UU046 has not been directly implicated in phase variation, it could potentially interact with proteins involved in this process, such as the tyrosine recombinases (RipX, XerC, and CodV) that mediate site-specific DNA inversion events .

  • Comparison with known virulence factors: Unlike the well-characterized multiple banded antigen (MBA), which is known to be immunodominant and phase-variable , UU046 may play more subtle roles in bacterial physiology or host interaction that remain to be elucidated.

Research investigating proteins like UU046 is essential for understanding the complete pathogenicity profile of Ureaplasma parvum, which has been associated with urogenital infections, chorioamnionitis, and bronchopulmonary dysplasia .

What experimental approaches can be used to study UU046 function?

Several experimental approaches can be employed to elucidate the function of the uncharacterized UU046 protein:

  • Protein localization studies:

    • Immunofluorescence microscopy using antibodies against UU046

    • Cell fractionation followed by Western blotting

    • Surface protein biotinylation assays

  • Interaction studies:

    • Pull-down assays using recombinant UU046 to identify binding partners

    • Yeast two-hybrid screening

    • Co-immunoprecipitation experiments

    • Bacterial two-hybrid system for protein-protein interactions

  • Functional genomics approaches:

    • Gene knockout or knockdown (challenging in Ureaplasma due to limited genetic tools)

    • Heterologous expression in model organisms such as Mycoplasma pneumoniae (similar to approaches used for studying tyrosine recombinases)

    • Overexpression studies to identify phenotypic changes

  • Structural biology:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • NMR spectroscopy for protein dynamics

    • Computational modeling and prediction of functional domains

  • Immunological approaches:

    • Evaluation of host immune responses to recombinant UU046

    • Assessment of cytokine production (such as IL-6 and IL-1β) in response to UU046 exposure

    • Characterization of antibody responses in patient sera

How does UU046 compare to characterized proteins in other Ureaplasma serovars?

Comparative analysis of UU046 with proteins from other Ureaplasma serovars can provide insights into its evolutionary conservation and potential functional importance:

  • Sequence homology: Analysis of sequence conservation across the 14 described Ureaplasma serovars (4 belonging to U. parvum and 10 to U. urealyticum) can indicate functional constraints on the protein.

  • Genomic context: Examining the genomic neighborhood of UU046 across different serovars might reveal conserved genetic contexts that suggest functional relationships with adjacent genes.

  • Comparison with MBA proteins: The multiple banded antigen (MBA) represents the best-characterized surface protein in Ureaplasma species. While MBA contains serotype-specific and non-serotype-specific epitopes , UU046 may have different patterns of conservation that could inform its functional role.

  • Serovar-specific variants: Different serovars of Ureaplasma exhibit varying associations with clinical outcomes. For example, U. parvum serovar 3 is one of the most frequently isolated serovars in clinical samples . Understanding serovar-specific variations in UU046 could potentially correlate with these differential clinical associations.

  • Horizontal gene transfer considerations: Horizontal gene transfer has been observed among Ureaplasma species, and between Ureaplasma and other bacteria like Mycoplasma hominis . This process can generate chimeric proteins or isolates with markers from multiple serovars, potentially affecting UU046 sequence and function.

How can recombinant UU046 be used in diagnostic assay development?

Recombinant UU046 protein has potential applications in diagnostic assay development for Ureaplasma detection:

  • Serological assays:

    • While the MBA is currently the primary target for Ureaplasma serological assays, UU046 could potentially serve as an additional target for antibody detection in ELISA or Western blot formats .

    • A combined panel including UU046 and other Ureaplasma proteins might improve diagnostic sensitivity and specificity.

  • Multiplex detection systems:

    • Incorporation of UU046 into multiplex assays that simultaneously detect multiple sexually transmitted pathogens, alongside organisms like Trichomonas vaginalis, Neisseria gonorrhoeae, Gardnerella vaginalis, and Chlamydia trachomatis .

    • Such assays could be particularly valuable in populations with high co-infection rates.

  • Quantitative detection:

    • Development of quantitative PCR assays targeting the UU046 gene could complement protein-based detection methods.

    • Bacterial load quantification might help distinguish colonization from infection, although current evidence suggests bacterial load may not consistently correlate with symptoms .

  • Serovar typing:

    • If UU046 contains serovar-specific regions, it could potentially be used for molecular typing of Ureaplasma isolates, complementing existing typing methods.

Table 1: Comparison of detection methods incorporating UU046 for Ureaplasma diagnosis

Detection MethodTargetSensitivitySpecificityAdvantagesLimitations
ELISARecombinant UU046 proteinModerate to highVariableHigh-throughput, quantitativePotential cross-reactivity
Western blotRecombinant UU046 proteinModerateHighConfirmation of specific bindingLabor-intensive, qualitative
qPCRUU046 geneHighHighQuantitative, rapidCannot distinguish viable from non-viable bacteria
Multiplex PCRUU046 and other genesHighModerate to highDetects multiple pathogensComplex optimization

What are the best methods for expressing recombinant UU046 in prokaryotic systems?

Optimizing expression of recombinant UU046 in prokaryotic systems involves several critical considerations:

  • Expression vector selection:

    • pTrcHis TOPO or similar vectors with histidine tags facilitate purification and have been successfully used for Ureaplasma proteins .

    • Inducible promoter systems (such as T7 or trc) allow controlled expression.

    • Consideration of fusion partners (MBP, GST, SUMO) may improve solubility.

  • Expression host optimization:

    • E. coli BL21(DE3) or its derivatives are commonly used for recombinant protein expression.

    • Rosetta or CodonPlus strains may improve expression if codon bias is an issue.

    • Arctic Express or other cold-adapted strains may assist with proper folding of challenging proteins.

  • Expression conditions:

    • Temperature: Lower temperatures (16-25°C) often improve solubility but reduce yield.

    • Induction timing: Induction at mid-log phase (OD600 ~0.6-0.8) is typically optimal.

    • Inducer concentration: IPTG concentrations of 0.1-1.0 mM should be tested.

    • Duration: 4-16 hours of expression, with longer times at lower temperatures.

  • Scale-up considerations:

    • Batch consistency should be monitored via SDS-PAGE and activity assays.

    • Fermentation parameters need optimization for larger-scale production.

  • Troubleshooting strategies:

    • For insoluble protein, consider refolding protocols from inclusion bodies.

    • Co-expression with chaperones may improve proper folding.

    • Sequence optimization for E. coli expression may improve yields.

What protein purification approaches yield the highest purity of recombinant UU046?

A multi-step purification strategy is recommended to achieve high purity (>90%) of recombinant His-tagged UU046 protein :

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins binds the His-tagged protein.

    • Washing with increasing concentrations of imidazole (10-50 mM) removes weakly bound contaminants.

    • Elution with high imidazole (250-500 mM) recovers the target protein.

  • Intermediate purification:

    • Ion-exchange chromatography based on the theoretical pI of UU046.

    • Anion exchange (Q-Sepharose) for acidic proteins or cation exchange (SP-Sepharose) for basic proteins.

    • Gradient elution with increasing salt concentration.

  • Polishing step:

    • Size-exclusion chromatography separates based on molecular size and removes aggregates.

    • Superdex 200 or Sephacryl S-200 resins are appropriate for a protein of UU046's size.

  • Buffer optimization:

    • Final formulation in Tris/PBS-based buffer with 6% trehalose at pH 8.0 stabilizes the protein .

    • Addition of glycerol (5-50%) for long-term storage.

  • Quality control:

    • SDS-PAGE with Coomassie staining to verify >90% purity .

    • Western blotting with anti-His antibodies to confirm identity.

    • Mass spectrometry to verify molecular weight and sequence.

How can researchers validate the biological activity of recombinant UU046?

Since UU046 is uncharacterized, validating its biological activity presents unique challenges. The following approaches can be considered:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure.

    • Differential scanning fluorimetry to evaluate thermal stability.

    • Limited proteolysis to assess proper folding.

  • Functional assays:

    • DNA-binding assays if UU046 is predicted to interact with nucleic acids.

    • Enzymatic activity screens based on sequence-predicted functions.

    • Cell adhesion assays to test potential roles in host-cell interaction.

  • Immunological activity:

    • Antibody recognition using sera from patients with confirmed Ureaplasma infections.

    • Cytokine induction assays measuring IL-6 and IL-1β production in immune cells .

    • Complement activation assays.

  • Protein-protein interaction validation:

    • Surface plasmon resonance (SPR) to measure binding kinetics with potential partners.

    • Microscale thermophoresis for quantitative interaction analysis.

    • Bio-layer interferometry for real-time binding studies.

  • In silico prediction validation:

    • Experimental testing of functions predicted by bioinformatic analysis.

    • Mutation of predicted functional domains followed by activity assays.

What approaches are recommended for studying protein-protein interactions involving UU046?

To identify and characterize potential protein-protein interactions involving UU046, researchers should consider a combination of in vitro, in vivo, and in silico approaches:

  • Affinity-based methods:

    • Pull-down assays using recombinant His-tagged UU046 as bait.

    • Co-immunoprecipitation with antibodies against UU046.

    • Label transfer methods using photo-activatable crosslinkers.

  • Biophysical techniques:

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization.

    • Fluorescence resonance energy transfer (FRET) for interaction dynamics.

    • Analytical ultracentrifugation to study complex formation.

  • Cell-based assays:

    • Bacterial two-hybrid systems adapt yeast two-hybrid for prokaryotic proteins.

    • Split-protein complementation assays using fragments of reporter proteins.

    • Proximity-dependent biotin identification (BioID) for capturing transient interactions.

  • Computational predictions:

    • Molecular docking to predict interactions with known Ureaplasma proteins.

    • Coevolution analysis to identify potential interaction partners.

    • Interactome prediction based on homology to characterized protein networks.

  • Specific considerations for UU046:

    • Potential interactions with tyrosine recombinases RipX, XerC, and CodV that mediate phase variation in Ureaplasma .

    • Interactions with phase-variable proteins such as the multiple banded antigen (MBA) .

    • Potential involvement in protein complexes related to pathogenicity or survival.

Table 2: Comparison of methods for studying UU046 protein interactions

MethodStrengthsLimitationsApplication to UU046
Pull-down assaysDirect physical evidence, can identify novel partnersMay detect non-physiological interactionsInitial screening for UU046 binding partners
Co-immunoprecipitationCaptures interactions in near-native conditionsRequires specific antibodiesValidation of interactions in Ureaplasma cells
Bacterial two-hybridAllows screening of interaction librariesMay have false positives/negativesSystematic screening for UU046 interactors
SPR/BLIQuantitative binding kineticsRequires purified proteinsCharacterizing binding parameters of identified interactions
Crosslinking mass spectrometryMaps interaction interfacesComplex data analysisDetermining structural basis of UU046 interactions

What are the primary challenges in studying uncharacterized proteins like UU046?

Researchers face several significant challenges when investigating uncharacterized proteins like UU046:

  • Limited genetic tools for Ureaplasma:

    • The genetic manipulation of Ureaplasma species remains challenging, making functional genomics approaches difficult.

    • Heterologous expression in model organisms like Mycoplasma pneumoniae offers alternatives but may not fully recapitulate native function .

  • Difficulties in phenotype association:

    • Without known function, linking UU046 to specific phenotypes requires unbiased screening approaches.

    • The variable presence of Ureaplasma as both commensal and pathogen complicates association studies .

  • Complexity of Ureaplasma serovars:

    • The existence of 14 serovars with potential horizontal gene transfer complicates comparative analyses .

    • Some clinical isolates may be non-typeable or contain chimeric proteins from multiple serovars .

  • Technical challenges:

    • Expression and purification of full-length, properly folded protein.

    • Development of specific antibodies against UU046.

    • Validation of biological activity without known function.

  • Clinical relevance determination:

    • Establishing the relevance of UU046 to Ureaplasma pathogenicity requires careful clinical studies.

    • Bacterial load of Ureaplasma is not consistently associated with symptoms , complicating functional studies.

How might future research directions expand our understanding of UU046?

Several promising research directions could advance our understanding of UU046 function and significance:

  • Comprehensive proteomic profiling:

    • Comparative proteomics of different Ureaplasma serovars could reveal differential expression patterns of UU046.

    • Secretome analysis might determine if UU046 is secreted or surface-exposed.

  • Advanced structural biology approaches:

    • Cryo-EM could potentially determine the structure of UU046 in complex with interacting partners.

    • Integrative structural biology combining multiple techniques may overcome challenges of single methods.

  • Systems biology integration:

    • Network analysis placing UU046 in the broader context of Ureaplasma protein interaction networks.

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics data.

  • Clinical correlation studies:

    • Examining antibody responses to UU046 in different patient populations.

    • Correlating UU046 sequence variants with clinical outcomes.

    • Investigation of UU046 in the context of polymicrobial infections.

  • Improved model systems:

    • Development of better genetic tools for Ureaplasma.

    • Organoid or tissue culture models that better recapitulate host-pathogen interactions.

    • Animal models of Ureaplasma infection to study UU046 in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.