Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU158 (UU158)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UU158; Uncharacterized protein UU158
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
UU158
Target Protein Sequence
MTKQEFKAITKELFFFNKKRLMLWIAILIFVIAFAMIIVFVPFFNFNDKIKSLFDKLKHI NWQDPTALFGLVFSVLGYLITALSIPLKVFELMLMLRFRLMLAKLIKDGILDPKAFIDDI RHSYLSRRKQRKLEEEIEYLKRIKSDY
Uniprot No.

Target Background

Database Links

KEGG: uur:UU158

STRING: 273119.UU158

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Ureaplasma parvum serovar 3 and how is it classified taxonomically?

Ureaplasma parvum (previously classified as U. urealyticum biovar 1) is one of two species in the Ureaplasma genus, with the other being U. urealyticum (previously U. urealyticum biovar 2). U. parvum has been divided into three subtypes represented by serovars 1, 3/14, and 6. Serovar 3/14 is one of the most prevalent subtypes, constituting approximately 48% of U. parvum isolates identified in clinical specimens . The taxonomic reclassification was supported by genetic analysis of 16S rRNA genes, urease gene subunits, and the multiple-banded antigen (MBA) genes, which provided evidence for dividing the original U. urealyticum into two distinct species .

What molecular methods are available for identifying Ureaplasma parvum serovar 3?

Several PCR-based methods have been developed for the identification and differentiation of Ureaplasma species and serovars:

Primer PairTargetSpecificityApplication
UPS1-UPA, UPS1-UPA1, UPS-UPSA, UPS2-UPA2, UMS-57–UMA222Various gene regionsAll 4 serovars of U. parvumSpecies identification
UMS-125–UMA269MBA geneSerovar 3/14 onlySpecific serovar identification
U. parvum primer/probe setUP063 gene (NP_077893)All 4 U. parvum serovarsReal-time PCR detection

For specific identification of serovar 3, primers targeting the MBA gene (UMS-125–UMA269) have been demonstrated to amplify only serovar 3 or 14 . Real-time PCR methods have also been developed using primers and probes that anneal to the 477-bp UP063 gene, which encodes a conserved hypothetical protein identical in all four U. parvum serovars, including serovar 3 . For more discriminatory identification, serovar-specific primers and probes based on unique genomic regions with <80% identity matches to other serovars can be utilized .

How can I confirm the successful expression of recombinant UU158 protein?

The confirmation of successful expression of recombinant UU158 protein requires a systematic approach:

  • SDS-PAGE analysis: Visualize the expressed protein band at the expected molecular weight.

  • Western blot: Use anti-His tag antibodies (if a His-tag was incorporated) or specific antibodies against UU158.

  • Mass spectrometry: Perform peptide mass fingerprinting or LC-MS/MS analysis of the purified protein.

  • Functional assays: Depending on predicted functions, develop appropriate biochemical assays.

When analyzing expression, it's essential to compare the results with appropriate positive and negative controls. A time-course analysis of expression can also provide insights into optimal induction periods and protein accumulation patterns.

What strategies are recommended for structural characterization of the uncharacterized UU158 protein?

For comprehensive structural characterization of UU158, a multi-technique approach is recommended:

When designing experiments for structural studies, consider protein stability conditions, buffer optimization, and potential binding partners that might stabilize the protein structure. Computational approaches such as homology modeling, if suitable homologous structures exist, can provide preliminary structural insights to guide experimental approaches.

How can I resolve contradictory findings in the literature regarding Ureaplasma protein functions?

Resolving contradictions in the biomedical literature, particularly regarding protein functions, requires systematic analysis of the context in which findings were reported:

  • Comprehensive literature review: Document all claims and their supporting evidence.

  • Study design analysis: Compare methodological approaches, including expression systems, purification methods, and functional assays.

  • Experimental conditions assessment: Analyze differences in pH, temperature, buffer composition, and the presence of cofactors.

  • Species and serovar verification: Confirm that comparisons are made between the same species and serovars, as misclassification can lead to apparent contradictions.

Automated text analysis techniques can facilitate this process by extracting claims from the literature and flagging potentially contradictory statements . When analyzing contradictions, normalize terms and acronyms to ensure proper comparison of findings, as this has been noted as a challenge in automatic detection of contradictory claims .

What are the optimal expression systems for producing functional recombinant UU158 protein?

The choice of expression system significantly impacts the yield, solubility, and functionality of recombinant proteins. For UU158, consider these options:

Expression SystemAdvantagesLimitationsSuitability for UU158
E. coliRapid growth, high yields, simple geneticsLimited post-translational modifications, potential inclusion body formationGood for initial characterization and structural studies
Yeast (S. cerevisiae, P. pastoris)Eukaryotic folding machinery, moderate post-translational modificationsLonger expression time, potential hyperglycosylationSuitable if proper folding is challenging in E. coli
Insect cellsAdvanced eukaryotic system, complex post-translational modificationsTechnical complexity, higher costConsider if mammalian-like modifications are necessary
Mammalian cellsNative-like post-translational modificationsHighest cost, technical complexity, lower yieldsBest for functional studies requiring authentic modifications

For initial characterization, an E. coli-based expression system with solubility-enhancing tags (such as MBP or SUMO) may provide sufficient material for preliminary studies. If functional assays indicate that post-translational modifications are essential, progression to eukaryotic expression systems would be warranted.

What controls should be included when studying protein-protein interactions involving UU158?

When investigating protein-protein interactions involving UU158, proper controls are essential to ensure data reliability:

  • Negative controls:

    • Non-interacting protein pairs

    • Buffer-only samples

    • Empty vector controls

    • Blocking peptides for antibody-based methods

  • Positive controls:

    • Known interacting protein pairs from Ureaplasma

    • Tagged control proteins with verified interaction partners

  • Method-specific controls:

    • For pull-down assays: Pre-clearing steps, non-specific binding controls

    • For co-immunoprecipitation: IgG controls, reverse IP validation

    • For yeast two-hybrid: Autoactivation controls, strength-of-interaction controls

    • For surface plasmon resonance: Reference surface controls, concentration series

Include biological replicates (different protein preparations) and technical replicates to assess reproducibility. Additionally, validate interactions using at least two independent methods, as each technique has inherent limitations and biases.

How should quantitative PCR be optimized for studying UU158 gene expression?

Optimization of qPCR for UU158 gene expression analysis requires attention to several parameters:

  • Primer design considerations:

    • Design primers to span exon-exon junctions (if applicable)

    • Target unique regions with 100% sequence identity to serovar 3

    • Ensure amplicon size of 70-150 bp for optimal amplification efficiency

  • Reference gene selection:

    • Use multiple reference genes for normalization

    • Validate stability of reference genes under experimental conditions

    • Consider genes that maintain stable expression across different growth conditions

  • Standard curve preparation:

    • Use purified PCR products or plasmids containing the target sequence

    • Prepare a 5-point standard curve with 10-fold dilutions

    • Ensure efficiency between 90-110% and R² > 0.99

  • Data analysis:

    • Apply appropriate normalization methods (ΔΔCt or standard curve)

    • Perform statistical analysis on biological replicates (minimum n=3)

    • Report data with proper error metrics (standard deviation or standard error)

The specificity of amplification can be confirmed through melt curve analysis and by testing primers against related Ureaplasma species to ensure no cross-reactivity, particularly with U. urealyticum serovars .

What bioinformatic approaches are most effective for predicting UU158 function?

For predicting the function of uncharacterized proteins like UU158, a multi-tiered bioinformatic approach yields the most comprehensive results:

  • Sequence-based methods:

    • PSI-BLAST for distant homology detection

    • Multiple sequence alignment with characterized proteins

    • Motif and domain identification (Pfam, PROSITE, InterPro)

    • Transmembrane segment prediction (TMHMM, Phobius)

    • Signal peptide prediction (SignalP)

  • Structure-based methods:

    • Homology modeling using templates with similar sequences

    • Threading approaches for fold recognition

    • Ab initio modeling for novel fold prediction

    • Binding site prediction (CASTp, FTSite)

  • Genomic context methods:

    • Gene neighborhood analysis

    • Gene fusion detection

    • Phylogenetic profiling

    • Expression correlation analysis

  • Integration methods:

    • Protein-protein interaction network analysis

    • Machine learning approaches combining multiple features

    • Consensus functional prediction from multiple algorithms

When applying these methods to UU158, prioritize results with strong statistical support and consistency across multiple approaches. Cross-validate predictions with available experimental data from related Ureaplasma proteins.

How can I address potential contradictions in experimental results when characterizing UU158?

When encountering contradictory results in UU158 characterization experiments, implement a systematic approach to identify sources of variation:

  • Experimental variables assessment:

    • Compare protein preparation methods (tags, purification protocols)

    • Analyze buffer composition differences (pH, salt concentration, additives)

    • Review assay conditions (temperature, incubation time, reagent concentrations)

    • Verify protein quality (purity, aggregation state, stability)

  • Statistical evaluation:

    • Perform power analysis to ensure adequate sample sizes

    • Apply appropriate statistical tests for the data distribution

    • Use correction methods for multiple comparisons

    • Consider Bayesian approaches for integrating prior knowledge

  • Validation strategies:

    • Reproduce experiments with standardized protocols

    • Use orthogonal methods to test the same hypothesis

    • Employ positive and negative controls consistently

    • Consider blind experimental design to reduce bias

  • Collaborative verification:

    • Engage independent laboratories to validate key findings

    • Share detailed protocols and materials to ensure reproducibility

Document and report all experimental conditions meticulously, as context-dependent protein behavior can explain apparent contradictions in the literature . Consider establishing a standardized characterization protocol for UU158 to facilitate comparison of results across studies.

What are the best approaches for studying the role of UU158 in Ureaplasma pathogenesis?

Investigating the role of UU158 in Ureaplasma pathogenesis requires a comprehensive approach:

  • Genetic manipulation strategies:

    • Gene knockout or knockdown (if genetic systems exist for Ureaplasma)

    • Heterologous expression in model organisms

    • Site-directed mutagenesis of key predicted functional residues

    • CRISPR interference for conditional repression

  • Host-pathogen interaction models:

    • Cell culture infection models (epithelial cells, immune cells)

    • Ex vivo tissue models (respiratory, urogenital)

    • Animal models of Ureaplasma infection

    • 3D organoid systems for tissue-specific responses

  • Molecular and cellular techniques:

    • Localization studies (immunofluorescence, electron microscopy)

    • Protein-protein interaction studies with host factors

    • Transcriptomics of host response to wild-type vs. UU158-modified strains

    • Proteomics to identify post-translational modifications

  • Clinical correlation studies:

    • Analysis of UU158 expression in clinical isolates

    • Correlation of UU158 variants with disease severity

    • Antibody responses to UU158 in patient samples

When studying pathogenesis, it's crucial to distinguish between association and causation. Use the molecular Koch's postulates as a framework for establishing the role of UU158 in virulence or pathogenicity.

How can quantitative research methods improve our understanding of UU158 function?

Quantitative research approaches provide rigorous frameworks for investigating UU158 function:

  • Kinetic characterization methods:

    • Enzyme kinetics (if UU158 has enzymatic activity)

    • Binding kinetics (SPR, BLI, ITC for interaction partners)

    • Real-time monitoring of conformational changes

    • Single-molecule approaches for heterogeneous populations

  • Systems biology approaches:

    • Metabolic flux analysis in presence/absence of UU158

    • Network modeling of protein interactions

    • Mathematical modeling of pathway dynamics

    • Multi-omics data integration

  • Advanced statistical methods:

    • Multivariate analysis for complex datasets

    • Machine learning for pattern recognition

    • Bayesian methods for hypothesis testing

    • Meta-analysis of multiple experimental approaches

  • Quantitative imaging:

    • FRET/FLIM for protein-protein interactions

    • Single-particle tracking for dynamic behavior

    • Super-resolution microscopy for spatial organization

    • Correlative light-electron microscopy for structural context

These quantitative approaches help move beyond descriptive characterization to mechanistic understanding by providing measurable parameters and testable models . When applying these methods, focus on establishing causality through carefully designed experiments with appropriate controls and statistical power.

What are common pitfalls in protein purification of recombinant Ureaplasma proteins and how can they be addressed?

Purification of recombinant Ureaplasma proteins presents several challenges:

ChallengePotential CausesSolutions
Low solubilityHydrophobic domains, improper foldingOptimize expression temperature, use solubility tags (MBP, SUMO), screen buffer conditions
Proteolytic degradationHost proteases, intrinsic instabilityAdd protease inhibitors, reduce expression time, engineer out susceptible sites
Co-purifying contaminantsNon-specific binding, similar propertiesImplement multi-step purification, optimize wash conditions, consider on-column refolding
Loss of activityDenaturation, cofactor loss, oxidationMaintain reducing conditions, add stabilizing agents, include cofactors in buffers
AggregationConcentration-dependent effects, domain interactionsOptimize protein concentration, add stabilizers, consider detergents for membrane proteins

For specific troubleshooting of UU158 purification, start with small-scale optimization experiments to identify critical parameters before scaling up. Monitor protein quality at each step using analytical techniques such as dynamic light scattering, size exclusion chromatography, and activity assays if available.

How can I address the challenge of distinguishing between serovar 3 and serovar 14 in experimental systems?

Distinguishing between Ureaplasma parvum serovars 3 and 14 presents a significant challenge as they are often grouped together in molecular typing systems. To address this:

  • Sequence-based approaches:

    • Target regions with nucleotide differences between serovars 3 and 14

    • Design high-resolution melt (HRM) analysis assays for SNP detection

    • Implement restriction fragment length polymorphism (RFLP) analysis of MBA genes

    • Use whole genome sequencing for definitive identification

  • Serological methods:

    • Develop serovar-specific monoclonal antibodies

    • Perform cross-absorption studies to remove shared epitopes

    • Use competitive ELISA to distinguish specific binding

  • Molecular strategies:

    • Design nested PCR approaches with increased specificity

    • Implement digital PCR for absolute quantification and higher sensitivity

    • Use CRISPR-based nucleic acid detection systems

  • Control strategies for research:

    • Maintain well-characterized reference strains

    • Sequence-verify all experimental strains prior to use

    • Include both serovars in experimental designs when distinction is uncertain

When working with UU158, verify the serovar identity of your strain through sequencing of multiple genetic markers, as the primer pair UMS-125–UMA269 amplifies both serovar 3 and serovar 14 . This verification is critical for accurate interpretation of experimental results and comparison with published studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.