Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU159 (UU159)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
UU159; Uncharacterized protein UU159
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
UU159
Target Protein Sequence
MMNNKNKFKNKEWKFSKKQVQLIYLTSSIISGLFLGLALLSTYLIAGLPNDNAFVLFVKE QKFYFPFFMTIGFINLIISMLTLLPTLKTLWRTVAKMHQYGDLSKEEFEALDILVEQIRN RYISVENIKAVISSNNYKTLDEELKKLEQQEKQLKIQEQEQKVKRLEQEIIKDDKTRVQS DY
Uniprot No.

Target Background

Database Links

KEGG: uur:UU159

STRING: 273119.UU159

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Ureaplasma parvum serovar 3 and how does it relate to other Ureaplasma species?

Ureaplasma parvum (previously known as U. urealyticum biovar 1) is one of two recognized Ureaplasma species that colonize humans, the other being U. urealyticum (previously biovar 2). Taxonomic reclassification occurred based on substantial evidence supporting this division, with U. parvum further separated into three subtypes represented by serovars 1, 3/14, and 6 . Serovar 3 is particularly significant as it represents one of the most prevalent subtypes, accounting for approximately 48% of U. parvum isolates in clinical samples .

This distinction between species is important for research purposes as molecular techniques have been developed to differentiate between the two species and their serovars. These techniques target specific regions like:

  • 16S rRNA gene and 16S rRNA-23S rRNA intergenic spacer regions

  • Urease gene subunits

  • Multiple-banded antigen (MBA) genes

What are the known physical and chemical properties of UU159 protein?

UU159 is an uncharacterized protein from Ureaplasma parvum serovar 3 (strain ATCC 700970) with the following properties:

PropertyValue
Length182 amino acids
Molecular Weight21.498 kDa
UniProt IDQ9PQY5
Full Amino Acid SequenceMMNNKNKFKNKEWKFSKKQVQLIYLTSSIISGLFLGLALLSTYLIAGLPNDNAFVLFVKEQKFYFPFFMTIGFINLIISMLTLLPTLKTLWRTVAKMHQYGDLSKEEFEALDILVEQIRNRYISVENIKAVISSNNYKTLDEELKKLEQQEKQLKIQEQEQKVKRLEQEIIKDDKTRVQSDY

The protein is available in recombinant form with N-terminal His-tag expressed in E. coli systems . Physical characterization can be further expanded through techniques like circular dichroism, dynamic light scattering, and nuclear magnetic resonance spectroscopy, which are standard approaches for uncharacterized proteins .

What experimental design considerations are important when studying UU159?

When designing experiments to study UU159, researchers should follow a systematic approach:

  • Define variables carefully:

    • Independent variables: Different experimental conditions (pH, temperature, ligands)

    • Dependent variables: Measurable outcomes (binding affinity, enzymatic activity)

    • Control for extraneous variables that might influence results

  • Formulate testable hypotheses:

    • Null hypothesis (H₀): "UU159 has no specific function in U. parvum pathogenicity"

    • Alternative hypothesis (H₁): "UU159 contributes to specific aspects of U. parvum pathogenicity"

  • Design experimental treatments systematically:

    • Include appropriate controls (positive, negative, vehicle)

    • Consider dose-response relationships if applicable

    • Develop treatments that directly address your hypotheses

  • Plan data collection and processing:

    • Record all measured values with associated uncertainties

    • Include table headers with appropriate units and precision

    • Ensure consistency in decimal places that reflect instrument precision

  • Evaluation and improvement:

    • Document what worked well and what didn't

    • Reference to error bars or standard deviation to address variability

    • Analyze reliability of results and whether data are sufficient to address research questions

How should recombinant UU159 be expressed and purified for functional studies?

For optimal expression and purification of recombinant UU159:

  • Expression system selection:

    • E. coli is the most commonly used host for UU159 expression

    • Consider using BL21(DE3) or similar strains optimized for protein expression

    • Alternative systems may include insect cell lines for more complex folding requirements

  • Vector design:

    • Include an N-terminal His-tag for affinity purification

    • Consider codon optimization for the expression host

    • Include appropriate promoter systems (T7 or similar strong promoters)

  • Expression conditions:

    • Test multiple induction temperatures (16°C, 25°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Optimize induction time (4-24 hours)

  • Purification strategy:

    • Primary purification: Ni-NTA affinity chromatography using the His-tag

    • Secondary purification: Size exclusion chromatography

    • Consider ion exchange chromatography as an additional step if needed

  • Quality control:

    • SDS-PAGE to verify size and purity

    • Western blot to confirm identity

    • Mass spectrometry for accurate mass determination and sequence verification

What approaches can be used to determine the cellular localization of UU159?

Determining cellular localization of UU159 is crucial for understanding its function. Several complementary approaches can be employed:

  • Computational prediction:

    • Use algorithms that predict subcellular localization based on sequence

    • Analyze for signal peptides, transmembrane domains, and localization motifs

    • The protein's amino acid sequence suggests potential membrane association due to hydrophobic regions

  • Fluorescence microscopy:

    • Generate GFP-UU159 fusion proteins

    • Express in Ureaplasma or model organisms

    • Co-localize with known compartment markers

  • Subcellular fractionation:

    • Separate cellular components (membrane, cytoplasm, etc.)

    • Detect UU159 by Western blotting in different fractions

    • Quantify relative abundance in each fraction

  • Immunogold electron microscopy:

    • Generate specific antibodies against UU159

    • Visualize precise localization at ultrastructural level

    • Quantify distribution across cellular compartments

  • Protease accessibility assays:

    • Determine if the protein is surface-exposed or protected

    • Use controlled protease digestion of intact cells vs. lysed cells

    • Analyze protection patterns to infer topology

What experimental approaches are most effective for characterizing the function of uncharacterized proteins like UU159?

Comprehensive functional characterization of uncharacterized proteins requires multiple complementary approaches:

  • Sequence-based analysis:

    • Homology detection using sensitive tools like PSI-BLAST, HHpred

    • Domain and motif identification using InterPro, PFAM

    • Secondary structure prediction

  • Structure prediction and modeling:

    • Use homology-based structure prediction (Swiss-Model, Phyre2)

    • Apply molecular dynamics simulations to probe potential binding sites

    • Structure-based functional inference

  • Interaction studies:

    • Yeast two-hybrid screening to identify protein partners

    • Pull-down assays with tagged UU159

    • Protein microarray analysis to identify potential ligands

  • Gene knockout/knockdown:

    • CRISPR-Cas9 gene editing if applicable to Ureaplasma

    • Antisense RNA approaches

    • Analysis of resulting phenotypes

  • Heterologous expression:

    • Express UU159 in model organisms

    • Assess phenotypic changes

    • Screen for functional complementation

  • Biochemical assays:

    • Screen for enzymatic activities (hydrolase, transferase, etc.)

    • Assess binding to nucleic acids, lipids, or other ligands

    • Test for post-translational modifications

How can protein-protein interactions of UU159 be identified and validated?

Identifying protein-protein interactions is crucial for understanding UU159's functional role:

  • Primary screening methods:

    • Yeast two-hybrid assays

    • Bacterial two-hybrid systems

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Protein microarrays

  • Validation techniques:

    • Co-immunoprecipitation with specific antibodies

    • Bioluminescence resonance energy transfer (BRET)

    • Förster resonance energy transfer (FRET)

    • Surface plasmon resonance (SPR)

  • Mapping interaction domains:

    • Deletion mutagenesis to identify critical regions

    • Alanine scanning of key residues

    • Peptide array analysis

  • Functional relevance assessment:

    • Disrupt specific interactions through targeted mutations

    • Evaluate phenotypic consequences

    • Assess changes in localization or activity

  • Computational analysis:

    • Predict interaction interfaces

    • Model complex structures

    • Simulate binding energetics

What role might UU159 play in Ureaplasma parvum pathogenicity?

While definitive functional characterization is pending, several approaches can elucidate potential roles in pathogenicity:

  • Expression pattern analysis:

    • Compare expression levels during infection vs. laboratory culture

    • Assess expression in different growth phases

    • Determine if expression is triggered by host factors

  • Host response studies:

    • Expose host cells to purified UU159

    • Measure inflammatory markers, cytokine production

    • Assess changes in host cell signaling pathways

  • Adherence and invasion assays:

    • Test if UU159 mediates attachment to host cells

    • Evaluate role in cellular invasion

    • Assess if antibodies against UU159 block infection

  • Animal model studies:

    • Compare wild-type vs. UU159 knockout strains in infection models

    • Evaluate colonization efficiency, persistence, and tissue damage

    • Test immunization with UU159 for protective effects

  • Clinical correlation:

    • Compare UU159 sequence variants between clinical isolates

    • Correlate specific variants with disease severity

    • Assess presence of anti-UU159 antibodies in patient samples

Current evidence suggests Ureaplasma species may be associated with conditions like urethritis and chronic prostatitis, though definitive links between specific proteins and pathogenicity are still being investigated .

How can structural biology approaches advance understanding of UU159?

Structural characterization provides critical insights into protein function:

  • X-ray crystallography approach:

    • Optimize purification for homogeneity and stability

    • Screen crystallization conditions systematically

    • Consider crystallization with potential binding partners

  • Cryo-electron microscopy:

    • Particularly valuable if UU159 forms larger complexes

    • Can resolve structures in more native states

    • May capture multiple conformational states

  • NMR spectroscopy:

    • Suitable for studying dynamics and ligand interactions

    • Requires isotope-labeled protein production

    • Can investigate protein-protein interaction interfaces

  • Computational approaches:

    • Molecular dynamics simulations to study conformational changes

    • Docking studies to predict binding partners

    • Integration with experimental structural data

  • Structure-function validation:

    • Site-directed mutagenesis of predicted functional residues

    • Biochemical assays to correlate structural features with function

    • Computational simulations to predict effects of mutations

What challenges might researchers face when studying UU159, and how can they be addressed?

Researchers should anticipate several challenges:

  • Expression and solubility issues:

    • Challenge: Recombinant expression may result in inclusion bodies

    • Solution: Optimize expression conditions (lower temperature, reduced induction)

    • Alternative: Consider fusion partners (SUMO, MBP) to enhance solubility

  • Functional annotation difficulties:

    • Challenge: Lack of obvious sequence homology to characterized proteins

    • Solution: Apply sensitive profile-based methods (HHpred, HMMER)

    • Integration: Combine multiple prediction approaches

  • Reproducibility concerns:

    • Challenge: Variable results across different experimental conditions

    • Solution: Standardize protocols rigorously

    • Documentation: Detail all experimental parameters comprehensively

  • Physiological relevance:

    • Challenge: In vitro findings may not reflect in vivo function

    • Solution: Validate with cellular and animal models

    • Context: Consider microenvironmental factors of natural Ureaplasma habitat

  • Publication bias:

    • Challenge: Negative results often remain unpublished

    • Solution: Pre-register studies and publish all outcomes

    • Awareness: Consider how industry funding might influence research direction

How does UU159 compare to other uncharacterized proteins in Ureaplasma species?

Comparative analysis with other uncharacterized proteins provides valuable context:

  • Genomic context analysis:

    • Examine gene neighborhoods across Ureaplasma species

    • Identify conserved gene clusters that might suggest functional relationships

    • Compare with syntenic regions in related organisms

  • Evolutionary conservation patterns:

    • Assess conservation levels across Ureaplasma species and strains

    • Identify highly conserved residues likely crucial for function

    • Compare evolutionary rates with proteins of known function

  • Expression correlation analysis:

    • Identify other genes with similar expression patterns

    • Look for co-regulation under specific conditions

    • Construct potential functional networks

  • Comparative structure prediction:

    • Compare predicted structural features across uncharacterized proteins

    • Identify structural motifs shared with characterized proteins

    • Group proteins by structural similarity

  • Systematic functional screens:

    • Apply consistent methodology across multiple uncharacterized proteins

    • Compare phenotypic effects of gene knockouts

    • Develop priority rankings for detailed characterization

Understanding UU159 in the context of other uncharacterized proteins (approximately 398 in F. nucleatum strain ATCC 25586) can illuminate shared functional pathways and prioritize targets for further investigation .

What emerging technologies could accelerate functional characterization of UU159?

Several cutting-edge approaches hold promise:

  • AlphaFold and similar AI structure prediction tools:

    • Generate highly accurate structural models without experimental data

    • Predict functional sites based on structural features

    • Guide rational experimental design

  • CRISPR-based functional genomics:

    • High-throughput gene editing in Ureaplasma

    • CRISPRi for controlled gene knockdown

    • CRISPR screening to identify genetic interactions

  • Single-cell technologies:

    • Analyze UU159 expression at single-cell resolution

    • Identify cell-to-cell variability in expression

    • Correlate with phenotypic heterogeneity

  • Proteome-wide interaction mapping:

    • Proximity labeling approaches (BioID, APEX)

    • Thermal proteome profiling

    • Cross-linking mass spectrometry

  • Microfluidics-based assays:

    • High-throughput screening for biochemical activities

    • Single-cell protein expression analysis

    • Automated assay miniaturization and parallelization

How might understanding UU159 contribute to broader knowledge about Ureaplasma biology?

Characterizing UU159 has implications beyond the single protein:

  • Gene regulation insights:

    • Understand regulatory networks controlling UU159 expression

    • Identify environmental triggers for expression

    • Map transcriptional control mechanisms in Ureaplasma

  • Host-pathogen interaction mechanisms:

    • Elucidate how Ureaplasma proteins interact with host cells

    • Identify potential virulence mechanisms

    • Develop interventions targeting key pathogenic processes

  • Evolution of minimal genomes:

    • Ureaplasma has one of the smallest genomes among free-living organisms

    • Understanding protein functions in this context reveals essential cellular processes

    • Provides insights into minimal genetic requirements for life

  • Comparative genomics applications:

    • Apply findings to related organisms

    • Identify conserved mechanisms across species

    • Reveal unique adaptations specific to Ureaplasma

  • Diagnostic and therapeutic development:

    • Assess potential of UU159 as a diagnostic biomarker

    • Evaluate as a therapeutic target if involved in pathogenicity

    • Develop specific inhibitors if function proves essential

What best practices should researchers follow when working with UU159?

Based on current knowledge and methodological considerations:

  • Experimental documentation:

    • Maintain comprehensive records of all experimental conditions

    • Document both successful and failed approaches

    • Share protocols and materials to enhance reproducibility

  • Multi-method validation:

    • Apply multiple independent techniques to verify findings

    • Triangulate results from different approaches

    • Consider both in vitro and in vivo validation

  • Collaborative approach:

    • Engage researchers with complementary expertise

    • Share preliminary findings through preprints

    • Establish standardized protocols within the field

  • Open science practices:

    • Deposit sequence and structural data in public repositories

    • Share reagents through material repositories

    • Publish negative results to prevent duplication of effort

  • Ethical considerations:

    • Ensure research independence from potential conflicts of interest

    • Consider implications of findings for patient populations

    • Address biosafety concerns appropriately

What key knowledge gaps remain to be addressed regarding UU159?

Despite progress, significant gaps remain:

  • Structural characterization:

    • No experimentally determined structure is currently available

    • Structural dynamics under different conditions remain unexplored

    • Interaction interfaces are not yet mapped

  • Biological function:

    • Primary molecular function remains uncharacterized

    • Cellular role is undefined

    • Potential involvement in pathogenicity is not established

  • Regulation and expression:

    • Factors controlling expression are unknown

    • Post-translational modifications have not been characterized

    • Turnover and degradation mechanisms are unexplored

  • Clinical relevance:

    • Correlation with disease states is not established

    • Potential as diagnostic or therapeutic target requires investigation

    • Immunogenicity and host response remain to be characterized

  • Evolutionary significance:

    • Origin and evolution across Ureaplasma species are not well documented

    • Selection pressures maintaining the gene are unknown

    • Functional conservation across species requires further study

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.