KEGG: uur:UU159
STRING: 273119.UU159
Ureaplasma parvum (previously known as U. urealyticum biovar 1) is one of two recognized Ureaplasma species that colonize humans, the other being U. urealyticum (previously biovar 2). Taxonomic reclassification occurred based on substantial evidence supporting this division, with U. parvum further separated into three subtypes represented by serovars 1, 3/14, and 6 . Serovar 3 is particularly significant as it represents one of the most prevalent subtypes, accounting for approximately 48% of U. parvum isolates in clinical samples .
This distinction between species is important for research purposes as molecular techniques have been developed to differentiate between the two species and their serovars. These techniques target specific regions like:
16S rRNA gene and 16S rRNA-23S rRNA intergenic spacer regions
Urease gene subunits
UU159 is an uncharacterized protein from Ureaplasma parvum serovar 3 (strain ATCC 700970) with the following properties:
| Property | Value |
|---|---|
| Length | 182 amino acids |
| Molecular Weight | 21.498 kDa |
| UniProt ID | Q9PQY5 |
| Full Amino Acid Sequence | MMNNKNKFKNKEWKFSKKQVQLIYLTSSIISGLFLGLALLSTYLIAGLPNDNAFVLFVKEQKFYFPFFMTIGFINLIISMLTLLPTLKTLWRTVAKMHQYGDLSKEEFEALDILVEQIRNRYISVENIKAVISSNNYKTLDEELKKLEQQEKQLKIQEQEQKVKRLEQEIIKDDKTRVQSDY |
The protein is available in recombinant form with N-terminal His-tag expressed in E. coli systems . Physical characterization can be further expanded through techniques like circular dichroism, dynamic light scattering, and nuclear magnetic resonance spectroscopy, which are standard approaches for uncharacterized proteins .
When designing experiments to study UU159, researchers should follow a systematic approach:
Define variables carefully:
Formulate testable hypotheses:
Design experimental treatments systematically:
Plan data collection and processing:
Evaluation and improvement:
For optimal expression and purification of recombinant UU159:
Expression system selection:
Vector design:
Expression conditions:
Test multiple induction temperatures (16°C, 25°C, 37°C)
Vary IPTG concentrations (0.1-1.0 mM)
Optimize induction time (4-24 hours)
Purification strategy:
Quality control:
SDS-PAGE to verify size and purity
Western blot to confirm identity
Mass spectrometry for accurate mass determination and sequence verification
Determining cellular localization of UU159 is crucial for understanding its function. Several complementary approaches can be employed:
Computational prediction:
Fluorescence microscopy:
Generate GFP-UU159 fusion proteins
Express in Ureaplasma or model organisms
Co-localize with known compartment markers
Subcellular fractionation:
Separate cellular components (membrane, cytoplasm, etc.)
Detect UU159 by Western blotting in different fractions
Quantify relative abundance in each fraction
Immunogold electron microscopy:
Generate specific antibodies against UU159
Visualize precise localization at ultrastructural level
Quantify distribution across cellular compartments
Protease accessibility assays:
Determine if the protein is surface-exposed or protected
Use controlled protease digestion of intact cells vs. lysed cells
Analyze protection patterns to infer topology
Comprehensive functional characterization of uncharacterized proteins requires multiple complementary approaches:
Sequence-based analysis:
Structure prediction and modeling:
Interaction studies:
Yeast two-hybrid screening to identify protein partners
Pull-down assays with tagged UU159
Protein microarray analysis to identify potential ligands
Gene knockout/knockdown:
CRISPR-Cas9 gene editing if applicable to Ureaplasma
Antisense RNA approaches
Analysis of resulting phenotypes
Heterologous expression:
Express UU159 in model organisms
Assess phenotypic changes
Screen for functional complementation
Biochemical assays:
Screen for enzymatic activities (hydrolase, transferase, etc.)
Assess binding to nucleic acids, lipids, or other ligands
Test for post-translational modifications
Identifying protein-protein interactions is crucial for understanding UU159's functional role:
Primary screening methods:
Yeast two-hybrid assays
Bacterial two-hybrid systems
Affinity purification coupled with mass spectrometry (AP-MS)
Protein microarrays
Validation techniques:
Co-immunoprecipitation with specific antibodies
Bioluminescence resonance energy transfer (BRET)
Förster resonance energy transfer (FRET)
Surface plasmon resonance (SPR)
Mapping interaction domains:
Deletion mutagenesis to identify critical regions
Alanine scanning of key residues
Peptide array analysis
Functional relevance assessment:
Disrupt specific interactions through targeted mutations
Evaluate phenotypic consequences
Assess changes in localization or activity
Computational analysis:
Predict interaction interfaces
Model complex structures
Simulate binding energetics
While definitive functional characterization is pending, several approaches can elucidate potential roles in pathogenicity:
Expression pattern analysis:
Compare expression levels during infection vs. laboratory culture
Assess expression in different growth phases
Determine if expression is triggered by host factors
Host response studies:
Expose host cells to purified UU159
Measure inflammatory markers, cytokine production
Assess changes in host cell signaling pathways
Adherence and invasion assays:
Test if UU159 mediates attachment to host cells
Evaluate role in cellular invasion
Assess if antibodies against UU159 block infection
Animal model studies:
Compare wild-type vs. UU159 knockout strains in infection models
Evaluate colonization efficiency, persistence, and tissue damage
Test immunization with UU159 for protective effects
Clinical correlation:
Compare UU159 sequence variants between clinical isolates
Correlate specific variants with disease severity
Assess presence of anti-UU159 antibodies in patient samples
Current evidence suggests Ureaplasma species may be associated with conditions like urethritis and chronic prostatitis, though definitive links between specific proteins and pathogenicity are still being investigated .
Structural characterization provides critical insights into protein function:
X-ray crystallography approach:
Optimize purification for homogeneity and stability
Screen crystallization conditions systematically
Consider crystallization with potential binding partners
Cryo-electron microscopy:
Particularly valuable if UU159 forms larger complexes
Can resolve structures in more native states
May capture multiple conformational states
NMR spectroscopy:
Suitable for studying dynamics and ligand interactions
Requires isotope-labeled protein production
Can investigate protein-protein interaction interfaces
Computational approaches:
Molecular dynamics simulations to study conformational changes
Docking studies to predict binding partners
Integration with experimental structural data
Structure-function validation:
Site-directed mutagenesis of predicted functional residues
Biochemical assays to correlate structural features with function
Computational simulations to predict effects of mutations
Researchers should anticipate several challenges:
Expression and solubility issues:
Challenge: Recombinant expression may result in inclusion bodies
Solution: Optimize expression conditions (lower temperature, reduced induction)
Alternative: Consider fusion partners (SUMO, MBP) to enhance solubility
Functional annotation difficulties:
Reproducibility concerns:
Physiological relevance:
Challenge: In vitro findings may not reflect in vivo function
Solution: Validate with cellular and animal models
Context: Consider microenvironmental factors of natural Ureaplasma habitat
Publication bias:
Comparative analysis with other uncharacterized proteins provides valuable context:
Genomic context analysis:
Examine gene neighborhoods across Ureaplasma species
Identify conserved gene clusters that might suggest functional relationships
Compare with syntenic regions in related organisms
Evolutionary conservation patterns:
Assess conservation levels across Ureaplasma species and strains
Identify highly conserved residues likely crucial for function
Compare evolutionary rates with proteins of known function
Expression correlation analysis:
Identify other genes with similar expression patterns
Look for co-regulation under specific conditions
Construct potential functional networks
Comparative structure prediction:
Compare predicted structural features across uncharacterized proteins
Identify structural motifs shared with characterized proteins
Group proteins by structural similarity
Systematic functional screens:
Apply consistent methodology across multiple uncharacterized proteins
Compare phenotypic effects of gene knockouts
Develop priority rankings for detailed characterization
Understanding UU159 in the context of other uncharacterized proteins (approximately 398 in F. nucleatum strain ATCC 25586) can illuminate shared functional pathways and prioritize targets for further investigation .
Several cutting-edge approaches hold promise:
AlphaFold and similar AI structure prediction tools:
Generate highly accurate structural models without experimental data
Predict functional sites based on structural features
Guide rational experimental design
CRISPR-based functional genomics:
High-throughput gene editing in Ureaplasma
CRISPRi for controlled gene knockdown
CRISPR screening to identify genetic interactions
Single-cell technologies:
Analyze UU159 expression at single-cell resolution
Identify cell-to-cell variability in expression
Correlate with phenotypic heterogeneity
Proteome-wide interaction mapping:
Proximity labeling approaches (BioID, APEX)
Thermal proteome profiling
Cross-linking mass spectrometry
Microfluidics-based assays:
High-throughput screening for biochemical activities
Single-cell protein expression analysis
Automated assay miniaturization and parallelization
Characterizing UU159 has implications beyond the single protein:
Gene regulation insights:
Understand regulatory networks controlling UU159 expression
Identify environmental triggers for expression
Map transcriptional control mechanisms in Ureaplasma
Host-pathogen interaction mechanisms:
Elucidate how Ureaplasma proteins interact with host cells
Identify potential virulence mechanisms
Develop interventions targeting key pathogenic processes
Evolution of minimal genomes:
Ureaplasma has one of the smallest genomes among free-living organisms
Understanding protein functions in this context reveals essential cellular processes
Provides insights into minimal genetic requirements for life
Comparative genomics applications:
Apply findings to related organisms
Identify conserved mechanisms across species
Reveal unique adaptations specific to Ureaplasma
Diagnostic and therapeutic development:
Assess potential of UU159 as a diagnostic biomarker
Evaluate as a therapeutic target if involved in pathogenicity
Develop specific inhibitors if function proves essential
Based on current knowledge and methodological considerations:
Experimental documentation:
Maintain comprehensive records of all experimental conditions
Document both successful and failed approaches
Share protocols and materials to enhance reproducibility
Multi-method validation:
Apply multiple independent techniques to verify findings
Triangulate results from different approaches
Consider both in vitro and in vivo validation
Collaborative approach:
Engage researchers with complementary expertise
Share preliminary findings through preprints
Establish standardized protocols within the field
Open science practices:
Deposit sequence and structural data in public repositories
Share reagents through material repositories
Publish negative results to prevent duplication of effort
Ethical considerations:
Ensure research independence from potential conflicts of interest
Consider implications of findings for patient populations
Address biosafety concerns appropriately
Despite progress, significant gaps remain:
Structural characterization:
No experimentally determined structure is currently available
Structural dynamics under different conditions remain unexplored
Interaction interfaces are not yet mapped
Biological function:
Primary molecular function remains uncharacterized
Cellular role is undefined
Potential involvement in pathogenicity is not established
Regulation and expression:
Factors controlling expression are unknown
Post-translational modifications have not been characterized
Turnover and degradation mechanisms are unexplored
Clinical relevance:
Correlation with disease states is not established
Potential as diagnostic or therapeutic target requires investigation
Immunogenicity and host response remain to be characterized
Evolutionary significance:
Origin and evolution across Ureaplasma species are not well documented
Selection pressures maintaining the gene are unknown
Functional conservation across species requires further study