Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU183 (UU183)

Shipped with Ice Packs
In Stock

Description

Introduction to Ureaplasma parvum and UU183

Ureaplasma parvum is a species of bacteria belonging to the class Mollicutes, characterized by the absence of a cell wall and small genome size. Ureaplasma parvum serovar 3 has been associated with various urogenital infections and adverse pregnancy outcomes, with strains like SV3F4 isolated from patients with infectious abortions . The reference strain ATCC 700970 has had its genome fully sequenced, enabling the identification and characterization of constituent proteins including UU183.

The UU183 protein derives its name from its gene designation in the Ureaplasma parvum genome. The "uncharacterized" classification indicates that while the protein has been identified through genomic analysis, its specific biological function remains largely unknown. This status is common for many proteins identified through whole genome sequencing projects, where the gene products are recognized but their functions have not yet been experimentally determined.

Understanding the structure, function, and potential role of UU183 in Ureaplasma parvum biology could provide valuable insights into the molecular mechanisms of this organism's survival and pathogenicity. This is particularly relevant given that Ureaplasma parvum possesses a minimal genome, suggesting that most of its proteins likely serve essential functions for bacterial viability or host interaction.

Molecular Properties

The key molecular properties of UU183 are summarized in the following table:

PropertyValueSource
Length291 amino acids
Molecular Mass34.3 kDa
UniProt IDQ9PQW0
Protein TypeTransmembrane Protein
Species OriginUreaplasma parvum serovar 3 (strain ATCC 700970)
Gene NameUU183
SynonymsUncharacterized protein UU183

The transmembrane nature of UU183 is particularly significant as membrane proteins often play crucial roles in cellular interactions, signaling, transport, and virulence in bacterial pathogens. In organisms with minimal genomes like Ureaplasma parvum, membrane proteins may serve multiple essential functions related to nutrient acquisition, environmental sensing, and host interaction.

Expression Systems and Methods

Recombinant UU183 protein is typically produced using Escherichia coli expression systems . The full-length protein (amino acids 1-291) is expressed with an N-terminal His-tag, which facilitates purification through affinity chromatography. Some commercial sources specify a 10×His-tag configuration , while others may use different tag arrangements.

The expression of full-length transmembrane proteins like UU183 presents several challenges, as noted in discussions of recombinant protein production . These challenges include:

  1. Protein hydrophobicity affecting solubility and expression efficiency

  2. Potential toxicity to the host cell

  3. Codon usage differences between Ureaplasma and the expression host

  4. Maintaining proper folding and native conformation

Despite these potential challenges, commercial sources report successful production of recombinant UU183 with high purity (>90% as determined by SDS-PAGE) . This suggests that optimization strategies have been developed to overcome the typical difficulties associated with membrane protein expression.

Transmembrane Characteristics

UU183 is definitively classified as a transmembrane protein , indicating that it is embedded within the cell membrane of Ureaplasma parvum. Analysis of its amino acid sequence reveals multiple hydrophobic regions characteristic of transmembrane domains, which typically form alpha-helical structures that span the lipid bilayer.

The transmembrane nature of UU183 is significant because membrane proteins serve critical functions in bacterial cells, including:

  1. Selective transport of molecules across the membrane

  2. Signal transduction and sensing of environmental changes

  3. Cell-to-cell communication and adhesion

  4. Structural integrity of the cell membrane

  5. Virulence and pathogenicity mechanisms

Given that Ureaplasma lacks a cell wall, membrane proteins like UU183 may play particularly important roles in maintaining cellular integrity, mediating interactions with host cells, and acquiring essential nutrients from the environment.

Potential Functional Significance

While specific functional studies of UU183 appear limited in the available literature, its classification as a transmembrane protein allows for informed hypotheses regarding its potential role in Ureaplasma parvum biology.

Ureaplasma parvum possesses several known virulence factors, including urease, multiple-banded antigen, hemolysin, serine/threonine kinase, and protein phosphatase . Although UU183 is not explicitly listed among these characterized virulence factors, its membrane localization raises the possibility that it may contribute to bacterial-host interactions or other aspects of pathogenesis.

The genome of Ureaplasma parvum encodes relatively few proteins compared to most other bacteria, suggesting that each protein, including UU183, likely serves important and possibly multiple functions for bacterial survival and replication. In this context, uncharacterized proteins represent significant opportunities for discovering novel aspects of Ureaplasma biology and potentially identifying new therapeutic targets.

Immunological and Diagnostic Applications

Recombinant UU183 has potential applications in immunological research and diagnostic development:

  1. Antibody production: The purified protein can be used to generate specific antibodies for detection and localization studies in Ureaplasma cultures or infected tissues.

  2. Serodiagnostic assays: If UU183 proves to be immunogenic during Ureaplasma infection, it could serve as an antigen in diagnostic tests for detecting antibodies in patient samples.

  3. Vaccine development: Characterizing the immunogenicity and conservation of UU183 across Ureaplasma strains could inform its potential as a vaccine component.

Pathogenesis Research

Understanding UU183's role could contribute significantly to our knowledge of Ureaplasma parvum pathogenesis:

  1. Virulence mechanisms: Investigating whether UU183 contributes to adhesion, invasion, or persistence in host tissues would enhance our understanding of Ureaplasma pathogenicity.

  2. Host response: Studying host immune responses to UU183 could reveal aspects of host-pathogen interaction during Ureaplasma infection.

  3. Therapeutic targeting: If UU183 proves essential for Ureaplasma survival or virulence, it could represent a novel target for antimicrobial development.

Expression and Purification Challenges

Research on transmembrane proteins like UU183 faces several technical challenges:

  1. Maintaining native conformation: Ensuring that recombinantly expressed UU183 maintains its natural folding and membrane topology is difficult but essential for functional studies .

  2. Solubility issues: The hydrophobic nature of transmembrane proteins often leads to aggregation or inclusion body formation during expression, requiring careful optimization of solubilization conditions .

  3. Purification complexity: Separating UU183 from other E. coli membrane proteins while maintaining its integrity requires specialized purification strategies beyond standard techniques .

  4. Stability concerns: Once purified, maintaining the stability of UU183 outside its native membrane environment presents ongoing challenges for downstream applications .

Functional Characterization Barriers

Determining the function of an uncharacterized protein like UU183 involves several obstacles:

  1. Limited genetic tools: The difficulty in genetically manipulating Ureaplasma species complicates approaches such as gene knockout or mutagenesis that would directly demonstrate UU183's function.

  2. Complex membrane environment: Recreating the native membrane environment of UU183 for functional studies is technically challenging but necessary for accurate characterization.

  3. Few known homologs: The limited sequence similarity between UU183 and well-characterized proteins in other organisms makes it difficult to predict function based on homology.

  4. Minimal literature base: The relative scarcity of published research specifically on UU183 means that investigators must develop novel approaches rather than building on established protocols.

Functional Genomics Approaches

Comparative and functional genomics offer powerful approaches for understanding UU183:

  1. Transcriptional profiling: Analyzing when and under what conditions UU183 is expressed could provide clues to its function.

  2. Comparative genomics: Examining conservation and variation of UU183 across different Ureaplasma strains and related species might reveal its evolutionary importance and functional constraints.

  3. Protein interaction networks: Mapping the protein interaction network of Ureaplasma parvum could place UU183 in a functional context by identifying its interaction partners.

Role in Host-Pathogen Interactions

Investigating UU183's potential role in Ureaplasma pathogenesis represents a particularly promising direction:

  1. Adhesion studies: Testing whether UU183 contributes to adherence to host cells or extracellular matrix components.

  2. Immune recognition: Examining whether UU183 is recognized by the host immune system during infection and characterizing the resulting immune responses.

  3. Expression during infection: Analyzing UU183 expression levels during different stages of infection or under various environmental conditions resembling the host environment.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific requirement for the format, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
UU183; Uncharacterized protein UU183
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 700970)
Target Names
UU183
Target Protein Sequence
MDKKAKIYTWSHIILIVFSLVCLHWFFILSITIPNQTGFLINRVGQWINSSSTYAYKIDP RSLFYLNYTLNFNIALNASGIASIVLFICYILTFIFNLIMIGIIRSWRPSLLHLIIAILI WLAILYLFIIIMIKPNFNQIINNSYYTWLKNVIFNDQTLTLNKKNVILNTYINHYHLPII NDPQVALLDISKHQINNENLTFNPSYNYNANLYFTKAKLIYCTYTIIGIIFIISFIYYLS EIIKRCLLVNDNWKIKQHERKDGLNIKKRKNKQEIVAPDPILEEIFKELDL
Uniprot No.

Target Background

Database Links

KEGG: uur:UU183

STRING: 273119.UU183

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant UU183 production?

E. coli expression systems are predominantly used for UU183 recombinant production due to their cost-effectiveness and high yield potential . Most commercial and research preparations utilize E. coli with vectors containing His-tags to facilitate purification .

Expression SystemAdvantagesLimitationsTag Options
E. coliHigh yield, cost-effective, simple protocolsLimited post-translational modificationsN-terminal His (most common), Other affinity tags
Baculovirus/Insect cellsBetter folding of complex proteins, more eukaryotic-like modificationsHigher cost, longer production timeHis-tag, GST
Mammalian cellsNative-like folding and modificationsHighest cost, complex protocolsVarious affinity tags

The selection of expression system should be based on the intended application, with E. coli being suitable for most basic research applications where post-translational modifications are not critical .

What are recommended protocols for recombinant UU183 purification?

The standard purification protocol for His-tagged recombinant UU183 typically follows these steps:

  • Cell lysis: Use of sonication or chemical lysis in the presence of protease inhibitors

  • Clarification: Centrifugation to remove cell debris (typically 10,000-15,000 × g for 20-30 minutes)

  • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Washing: Multiple washes with increasing imidazole concentrations

  • Elution: Typically with 250-300 mM imidazole

  • Buffer exchange: Dialysis or gel filtration to remove imidazole

For optimal purity (>90%), additional purification steps may include size exclusion chromatography or ion exchange chromatography . The final preparation should be verified by SDS-PAGE and Western blotting using anti-His antibodies or serotype-specific antibodies if available .

How can researchers develop immunoassays using recombinant UU183?

Developing immunoassays using recombinant UU183 requires careful optimization of several parameters. Based on successful approaches with similar Ureaplasma proteins:

  • ELISA Development:

    • Coating optimization: Tests suggest concentrations between 1.25-2.5 μg/ml of purified recombinant protein in carbonate/bicarbonate buffer (pH 9.6)

    • Blocking: 3% bovine serum albumin in PBS for 1 hour at 37°C

    • Sample dilution: Optimization required, but 1:1000 has been effective for human sera testing

    • Detection: Anti-human IgG-peroxidase conjugate (1:1000 dilution) followed by appropriate substrate

    • Controls: Include both positive and negative control sera and appropriate blanks

  • Western Blot Optimization:

    • Protein loading: 0.5-1 μg per lane

    • Transfer conditions: Standard semi-dry or wet transfer protocols

    • Blocking: 5% non-fat milk in TBST

    • Antibody incubation: Primary antibodies at optimized dilutions (typically 1:800-1:3200 for monoclonal antibodies)

Cross-reactivity testing is essential as studies with other Ureaplasma antigens show potential cross-reactions between serotypes .

What approaches can determine if patient sera contain antibodies against UU183?

Detection of anti-UU183 antibodies in patient sera requires validated serological assays. Based on studies with similar Ureaplasma recombinant proteins:

  • ELISA Protocol:

    • Coat microplates with purified recombinant UU183 (optimal concentration determined empirically, typically 1-2.5 μg/ml)

    • Block non-specific binding sites with 3% BSA-PBS

    • Add diluted patient sera (1:1000 in 0.05% PBST)

    • Incubate and wash thoroughly (3-5 wash cycles)

    • Add labeled anti-human IgG antibody

    • Develop using appropriate substrate and read absorbance

  • Cut-off Determination:

    • Calculate initial cut-off value as mean OD plus 2 standard deviations from culture-negative controls

    • Adjust if necessary based on ROC curve analysis

    • Validate with known positive and negative samples

In a study using recombinant MBA antigens, 51% of sera from culture-positive women showed reactivity with one or both rMBAs, while only 15% of sera from culture-negative women reacted, indicating the potential of recombinant Ureaplasma proteins for serological testing .

How can recombinant UU183 contribute to Ureaplasma pathogenicity research?

Recombinant UU183 can serve as a valuable tool in understanding Ureaplasma pathogenicity through several research approaches:

  • Adhesion and invasion studies: Evaluating if UU183 mediates bacterial attachment to host cells

  • Immunomodulation analysis: Assessing host immune responses (pro-inflammatory cytokines, pattern recognition receptors) to purified UU183

  • Comparative analysis: Comparing antibody responses to UU183 in different patient populations (e.g., with adverse pregnancy outcomes versus healthy controls)

  • Structure-function relationships: Identifying functional domains through targeted mutagenesis

  • Serotype-specific responses: Comparing immune responses to UU183 versus other Ureaplasma proteins (like MBA) to understand serotype-specific pathogenicity

Research has shown that Ureaplasma infections can be associated with adverse pregnancy outcomes, and serotype-specific proteins may play roles in pathogenicity, although conclusive evidence linking specific proteins to virulence is still emerging .

What are optimal storage conditions for maintaining UU183 stability?

Proper storage is critical for maintaining the structural integrity and activity of recombinant UU183:

Storage FormRecommended ConditionsMaximum Storage TimeNotes
Lyophilized-20°C to -80°C12 monthsPreferred for long-term storage
Liquid-20°C with 50% glycerol6 monthsAvoid freeze-thaw cycles
Working aliquots4°CUp to 1 weekFor immediate use

For reconstitution of lyophilized protein, the recommended protocol is:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for freezer storage

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

Repeated freezing and thawing significantly reduces protein activity and should be avoided; all handling should be done on ice when possible .

How can researchers address solubility challenges with recombinant UU183?

As a predicted transmembrane protein, UU183 may present solubility challenges that can be addressed through several strategies:

  • Buffer optimization:

    • Test different pH ranges (usually 7.0-8.5)

    • Evaluate various salt concentrations (150-500 mM NaCl)

    • Include stabilizing agents (5-10% glycerol, 1-5 mM DTT)

    • Consider mild detergents for membrane proteins (0.05-0.1% Triton X-100, 0.5-1% CHAPS)

  • Expression optimization:

    • Lower induction temperature (16-25°C instead of 37°C)

    • Reduce inducer concentration

    • Use specialized E. coli strains designed for membrane proteins

    • Consider fusion partners that enhance solubility (MBP, SUMO, Thioredoxin)

  • Purification approaches:

    • Inclusion body isolation and refolding protocols

    • On-column refolding during purification

    • Gradual detergent exchange during purification

These strategies should be systematically tested to identify optimal conditions for maintaining UU183 in solution while preserving its native conformation.

What PCR and cloning strategies are recommended for UU183 gene amplification?

Based on successful approaches with Ureaplasma genes:

  • PCR Amplification Protocol:

    • Design primers flanking the UU183 coding sequence with appropriate restriction sites

    • Reaction mixture: 10 mM Tris HCl (pH 8.3), 50 mM KCl, 2.5 mM MgCl₂, 200 μM dNTPs, 1 μM primers, 0.025 U/μl Taq polymerase

    • Thermal cycling: Initial denaturation (94°C, 5 min); 30-35 cycles of denaturation (94°C, 30 sec), annealing (optimized temperature, 30 sec), extension (72°C, 1 min per kb); final extension (72°C, 10 min)

  • Cloning Strategy:

    • Vector selection: pTrcHis TOPO or similar expression vector with His-tag

    • Transformation into competent E. coli (DH5α for cloning, BL21(DE3) for expression)

    • Screening: Colony PCR and/or restriction digestion

    • Verification: Sequencing with vector-specific primers (e.g., pTrcHis Forward and pTrcHis Reverse)

This approach has been successful for cloning similar Ureaplasma genes and should be adaptable for UU183 with appropriate primer design considering the specific gene sequence.

How can researchers investigate potential cross-reactivity between UU183 and other Ureaplasma proteins?

Cross-reactivity studies are critical for understanding serotype-specific responses and assay specificity:

  • Experimental Design:

    • Express recombinant proteins from multiple Ureaplasma serotypes

    • Develop a panel of monoclonal antibodies against each serotype

    • Perform reciprocal testing using both Western blotting and ELISA

  • Analysis Protocol:

    • ELISA: Test each antibody against all recombinant proteins at standardized concentrations

    • Western blotting: Run standardized amounts of each protein, transfer, and probe with different antibodies

    • Calculate cross-reactivity percentages based on relative signal intensities

  • Data Interpretation:

    • Strong cross-reactions may indicate conserved epitopes

    • Serotype-specific reactions indicate unique epitopes

    • Pattern of cross-reactivity can inform diagnostic assay development

Studies with MBA antigens showed varying patterns of cross-reactivity: rMBA 3 exhibited cross-reactions with antibodies from multiple serotypes, while rMBA 6 showed more restricted cross-reactivity, demonstrating the importance of such analysis for any UU183-based assays .

What approaches can elucidate the functional role of UU183 in Ureaplasma biology?

As an uncharacterized protein, determining UU183's function requires a multi-faceted approach:

  • Bioinformatic Analysis:

    • Sequence homology searches against characterized proteins

    • Domain prediction and functional motif identification

    • Structural modeling using algorithms like AlphaFold2

    • Transmembrane topology prediction

  • Molecular and Cellular Techniques:

    • Gene knockout or silencing (if genetic systems are available for Ureaplasma)

    • Protein localization studies using fluorescent tags or immunofluorescence

    • Protein-protein interaction studies (pull-down assays, co-immunoprecipitation)

    • Host cell binding assays with purified protein

  • Functional Assays:

    • Evaluate membrane integrity changes in the presence of anti-UU183 antibodies

    • Test for enzymatic activities based on sequence predictions

    • Assess contribution to antibiotic resistance or stress responses

    • Examine role in host cell adherence or invasion

Researchers studying other bacterial membrane proteins have successfully used these approaches to characterize previously unknown functions, which could be applied to UU183 investigation.

How does UU183 compare with multiple banded antigen (MBA) in serological studies?

The multiple banded antigen (MBA) is a well-characterized Ureaplasma antigen, providing a useful comparison for UU183 studies:

FeatureMBAUU183
CharacterizationWell-characterized surface antigenUncharacterized transmembrane protein
Serological useEstablished use in antibody detectionPotential but unverified utility
Serotype specificityContains both serotype-specific and cross-reactive epitopesNot fully characterized
Size variationVariable size due to repeat regions (15-36 repeats observed)Consistent size (291 amino acids)
Expression levelHighly expressedExpression levels not well-documented

MBA has been successfully used in serological assays, with studies showing that 51% of sera from culture-positive women reacted with recombinant MBA antigens . This provides a benchmark for evaluating UU183's potential in similar applications, though direct comparative studies are needed.

What are the most promising future research directions for UU183?

Future research on UU183 should focus on:

  • Functional Characterization:

    • Determine cellular localization and membrane topology

    • Identify interaction partners within bacterial cells and with host factors

    • Evaluate contribution to bacterial physiology and pathogenesis

  • Diagnostic Development:

    • Assess value as a serological marker compared to established antigens

    • Develop multiplexed assays incorporating UU183 with other Ureaplasma antigens

    • Evaluate specificity and sensitivity in diverse patient populations

  • Structural Studies:

    • Determine three-dimensional structure through X-ray crystallography or cryo-EM

    • Identify functional domains and epitopes

    • Design structure-based functional studies

  • Therapeutic Applications:

    • Evaluate as a potential vaccine component

    • Assess as a target for therapeutic antibodies

    • Investigate as a diagnostic marker for treatment monitoring

The uncharacterized nature of UU183 presents opportunities for novel discoveries that could enhance understanding of Ureaplasma biology and pathogenesis.

What methodological approaches can overcome the challenges of working with UU183 in pathogenicity studies?

Working with UU183 in pathogenicity studies presents several challenges that can be addressed through:

  • Developing Expression Constructs:

    • Design truncated constructs excluding highly hydrophobic regions

    • Create chimeric proteins with soluble partners

    • Express domains separately for functional studies

  • Animal Model Development:

    • Establish appropriate animal models for Ureaplasma infection

    • Develop methods to measure UU183-specific immune responses in vivo

    • Compare wild-type and UU183-knockout strains if genetic systems permit

  • Host-Pathogen Interaction Analysis:

    • Use recombinant UU183 in binding assays with host cell components

    • Perform inhibition studies using anti-UU183 antibodies

    • Develop cell culture models to assess UU183 contributions to colonization

  • Advanced Techniques:

    • Single-cell analysis of host responses to UU183

    • Proteomics approaches to identify UU183 interaction networks

    • CRISPR-based methods for functional genomics in host cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.