Recombinant Ureaplasma parvum serovar 3 UPF0154 protein UPA3_0273 (UPA3_0273)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Ureaplasma parvum Serovar 3 UPF0154 Protein UPA3_0273 (UPA3_0273)

The Recombinant Ureaplasma parvum Serovar 3 UPF0154 Protein UPA3_0273 (UPA3_0273) is a full-length, His-tagged recombinant protein derived from Ureaplasma parvum serovar 3. Expressed in E. coli, this protein comprises 109 amino acids (aa 1–109) and is used in research to study Ureaplasma pathogenicity, molecular interactions, and diagnostic applications . Its UniProt accession number is B1AIQ4, and it is commercially available in lyophilized powder form with >90% purity as confirmed by SDS-PAGE .

3.1. Role in Pathogenicity Studies

Ureaplasma parvum serovar 3 is linked to human diseases, including microscopic hematuria (MH) and non-gonococcal urethritis (NGU) . While UPA3_0273’s specific function remains under investigation, its recombinant form is critical for:

  • Serotyping Assays: Used to distinguish U. parvum serovars (e.g., serovar 3 vs. 14) in clinical samples .

  • ELISA Development: Serves as an antigen in enzyme-linked immunosorbent assays to detect anti-Ureaplasma antibodies .

Pathogenicity Associations of Ureaplasma parvum Serovar 3

Disease/ConditionAssociation
Microscopic Hematuria (MH)Serovar 3 infection correlates with MH in female patients (HR = 1.354, P = 0.018) .
Non-Gonococcal UrethritisSerovar 3 detection in urine specimens highlights its role in urogenital infections .
Reinfection RiskHigher reinfection rates post-antibiotic treatment compared to other serovars .

Limitations and Future Directions

  • Functional Data Gaps: No studies explicitly describe UPA3_0273’s biochemical functions (e.g., enzymatic activity, ligand binding) .

  • Diagnostic Potential: Further validation is required to assess its utility in clinical diagnostics beyond serotyping .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are flexible to accommodate your specific requirements. Please clearly indicate your preferred format in the order notes section, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For accurate delivery timelines, kindly consult your local distributors.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. For dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
In general, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that tag.
Synonyms
UPA3_0273; UPF0154 protein UPA3_0273
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Target Names
UPA3_0273
Target Protein Sequence
MNFSSFIFKVSDVFKSVIHEASDVVTKADLDNANAHTHSLAVGLGIGIVLFLIAGLIIGY FISMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEIYNRAVKQK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0154 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining UPA3_0273 protein stability?

To maintain optimal stability of recombinant UPA3_0273 protein, the following storage conditions are recommended:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C to -80°CAliquoting is necessary for multiple use
Working aliquots4°CFor up to one week
Storage bufferTris/PBS-based buffer, pH 8.0 with 6% TrehaloseMaintains protein stability
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLAdd 5-50% glycerol for long-term storage
Freeze-thaw cyclesMinimizeRepeated freezing and thawing is not recommended

For reconstitution of lyophilized protein, it is advisable to centrifuge the vial briefly prior to opening to bring contents to the bottom . After reconstitution, adding glycerol to a final concentration of 50% and aliquoting for long-term storage at -20°C/-80°C is recommended to preserve protein activity and prevent degradation.

What are the structural characteristics of UPA3_0273 as a member of the UPF0154 protein family?

UPA3_0273 belongs to the UPF0154 protein family, which is characterized by several distinctive structural features:

  • It is a small protein (109 amino acids) with a predicted transmembrane domain, suggesting its localization in the bacterial membrane.

  • Analysis of its amino acid sequence shows a highly hydrophobic central region (residues 40-60: LAVGLGIGIVLFLIAGLIIGY), consistent with a transmembrane segment.

  • The protein contains several charged residues at the C-terminus (GRKPSESQINEIYNRAVKQK), which likely represents a cytoplasmic domain.

This protein's structure-function relationship remains largely uncharacterized, similar to other UPF (Uncharacterized Protein Family) proteins, which represents an area for further investigation through structural biology approaches such as X-ray crystallography or NMR spectroscopy.

How should researchers design experiments to investigate the potential role of UPA3_0273 in Ureaplasma parvum pathogenesis?

When investigating UPA3_0273's role in Ureaplasma parvum pathogenesis, a multi-faceted experimental approach is recommended:

  • Gene knockout/knockdown studies:

    • Generate UPA3_0273 mutants using targeted gene disruption

    • Compare virulence, colonization, and inflammatory responses between wild-type and mutant strains in appropriate cell culture or animal models

  • Host-pathogen interaction analysis:

    • Assess the interaction of purified UPA3_0273 with host cells

    • Evaluate changes in host cell signaling pathways, cytokine production, and cell death mechanisms

    • Use immunoprecipitation coupled with mass spectrometry to identify host protein binding partners

  • Clinical correlation studies:

    • Compare UPA3_0273 expression levels between clinical isolates from symptomatic and asymptomatic carriers

    • Assess genetic variations in UPA3_0273 among different clinical isolates and correlate with disease severity

These approaches should be used in conjunction with appropriate controls and validated using complementation studies to confirm that observed phenotypes are directly attributable to UPA3_0273 .

What methodological considerations are critical when expressing and purifying recombinant UPA3_0273?

Expression and purification of recombinant UPA3_0273 requires careful methodological considerations:

StageCritical ConsiderationsRecommended Approach
Expression systemMembrane protein expression challengesE. coli BL21(DE3) with codon optimization for prokaryotic expression
Vector designTag selection and placementN-terminal His-tag with optional protease cleavage site
Induction conditionsProtein solubility and toxicityLower temperature (16-25°C), reduced IPTG concentration (0.1-0.5 mM)
Lysis bufferMembrane protein extractionInclude appropriate detergents (e.g., n-dodecyl β-D-maltoside)
Purification strategyMaintain native conformationIMAC followed by size exclusion chromatography
Quality controlAssess purity and functionalitySDS-PAGE, Western blot, mass spectrometry

When working with membrane proteins like UPA3_0273, solubilization with appropriate detergents is crucial. Additionally, researchers should consider the effect of the His-tag on protein function and remove it if necessary using specific proteases if experimental design requires tag-free protein .

How does UPA3_0273 relate to the UPF1 pathway in potential quality control mechanisms?

While UPA3_0273 (as a UPF0154 family protein) and UPF1 share a nomenclature prefix, they represent distinct protein families with different functions. Understanding their potential relationship requires careful consideration:

  • UPF1 is a key component in nonsense-mediated mRNA decay (NMD) and protein quality control pathways. It has well-characterized roles in:

    • Recognition of premature termination codons (PTCs)

    • Formation of the SMG1-UPF1-eRF1/3 (SURF) complex

    • Hyperphosphorylation-dependent signaling to inhibit additional rounds of translation

    • E3 ubiquitin ligase activity that may drive proteasomal degradation of PTC-polypeptides

  • UPA3_0273, as a member of the UPF0154 family, has no established functional relationship with UPF1 pathways based on current literature.

  • Research possibilities to explore potential connections:

    • Investigate whether UPA3_0273 undergoes quality control mechanisms regulated by UPF1

    • Examine if UPA3_0273 expression is affected by NMD pathways in Ureaplasma

    • Assess whether UPA3_0273 plays a role in Ureaplasma-specific mRNA stability or protein quality control

This represents an unexplored research area that could provide insights into bacterial adaptations of quality control mechanisms known in eukaryotes .

What is the significance of UPA3_0273 in relation to Ureaplasma parvum's association with adverse pregnancy outcomes?

Research into Ureaplasma parvum's association with adverse pregnancy outcomes, particularly preterm birth (PTB), represents an important area for UPA3_0273 investigation:

  • Ureaplasma parvum has been associated with preterm birth in clinical studies, with genotype potentially playing a role in pathogenicity .

  • To investigate UPA3_0273's potential role in this clinical context, researchers should consider:

    • Genotyping approaches: Using PCR-based methods similar to those employed for Ureaplasma parvum serovar determination to identify genetic variations in UPA3_0273 across clinical isolates

    • Transcriptomic analysis: Comparing UPA3_0273 expression levels between isolates from women with preterm birth versus term birth

    • Model systems: Using appropriate in vitro and in vivo models to assess the effect of UPA3_0273 on:

      • Chorioamniotic membrane integrity

      • Inflammatory responses in gestational tissues

      • Interactions with other microorganisms (e.g., Candida albicans) that may influence pathogenicity

  • Correlation studies should examine UPA3_0273 expression or variants in relation to:

    • Gestational age at delivery

    • Histological chorioamnionitis

    • Inflammatory markers in amniotic fluid

    • Response to antibiotic treatment

This research direction could potentially identify UPA3_0273 as a biomarker or therapeutic target for preventing Ureaplasma-associated preterm birth .

What molecular detection methods are most effective for studying UPA3_0273 expression in clinical and experimental samples?

Effective molecular detection of UPA3_0273 requires selecting appropriate methods based on research objectives:

Detection MethodApplicationsAdvantagesLimitations
Real-time PCRGene expression quantificationHigh sensitivity, specific quantificationDetects only DNA/RNA, not protein
High-resolution melt PCRGenotyping, variant detectionRapid discrimination between genotypesRequires optimization for each target
ImmunoblottingProtein expression detectionDirect protein visualizationRequires specific antibodies
Mass spectrometryProtein identification, PTMsHigh specificity, can detect modificationsComplex sample preparation, expensive
ELISAProtein quantificationHigh-throughput, quantitativeRequires specific antibodies

For clinical sample analysis, a combined approach is recommended:

  • Initial screening using culture-based methods to isolate Ureaplasma parvum, followed by species-specific PCR using primers targeting the urease gene as described by Yi et al.

  • For genotyping, high-resolution melt (HRM) PCR assays targeting the multiple-banded antigen gene can be adapted to analyze UPA3_0273 genetic variants

  • For expression studies, develop specific antibodies against UPA3_0273 for immunodetection methods, or use targeted mass spectrometry approaches for precise protein quantification

These methodological considerations ensure accurate and reliable detection of UPA3_0273 in various experimental and clinical contexts.

What are the most promising future research directions for understanding UPA3_0273 function?

Several promising research directions could advance our understanding of UPA3_0273:

  • Structural biology approaches: Determine the three-dimensional structure of UPA3_0273 using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to gain insights into its potential function.

  • Interactome analysis: Identify protein-protein interactions using techniques such as bacterial two-hybrid systems, pull-down assays, or proximity labeling approaches to uncover functional protein networks.

  • Comparative genomics: Analyze UPA3_0273 homologs across different Ureaplasma species and serovars to understand evolutionary conservation and potential functional importance.

  • Systems biology approaches: Integrate transcriptomic, proteomic, and metabolomic data to place UPA3_0273 within the broader context of Ureaplasma parvum physiology and pathogenesis.

  • Translational research: Investigate UPA3_0273 as a potential diagnostic marker or therapeutic target for Ureaplasma-associated conditions, particularly in the context of reproductive health.

By pursuing these research directions, investigators can contribute to unraveling the biological significance of this uncharacterized protein and potentially develop new strategies for diagnosing and treating Ureaplasma-associated diseases.

How can researchers effectively present UPA3_0273 data in scientific publications?

When presenting UPA3_0273 data in scientific publications, researchers should follow these guidelines for maximum impact:

  • Table design considerations:

    • Ensure table titles clearly describe content and are written in past tense

    • Design column headers to be descriptive and clearly indicate the nature of data

    • Present tables that are understandable on their own, without reference to the text

    • Divide large amounts of information into clear categories with appropriate columns

  • Figure selection criteria:

    • Use tables for presenting precise numerical values and specific data

    • Use figures for showing trends, patterns, and relationships between datasets

    • Present text-only information when data is limited (fewer than 2 columns)

  • Data presentation strategy:

    • Include only results relevant to the research question posed in the introduction

    • Avoid repeating identical information in tables, figures, and text

    • Present comparative data in well-designed tables rather than lists

    • Use LaTeX for mathematical expressions if needed

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.