Recombinant Ureaplasma urealyticum serovar 10 ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpE; UUR10_0152; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Target Names
atpE
Target Protein Sequence
MSSFIDITNVISSHVEANLPAVSAENVQSLANGAGIAYLGKYIGTGITMLAAGAVGLMQG FSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSILIIFVA
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 catalytic core (extramembranous) and the F0 membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. A key component of the F0 channel, the ATP synthase subunit c plays a direct role in transmembrane translocation. A homomeric c-ring, typically composed of 10-14 subunits, forms the central stalk rotor element, interacting with the F1 delta and epsilon subunits.
Database Links
Protein Families
ATPase C chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant Ureaplasma urealyticum serovar 10 ATP synthase subunit c?

For optimal stability of recombinant Ureaplasma urealyticum serovar 10 ATP synthase subunit c, the following storage protocol is recommended:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution in deionized sterile water (concentration 0.1-1.0 mg/mL), add glycerol to a final concentration of 50%

  • Aliquot to prevent repeated freeze-thaw cycles

  • For long-term storage, maintain at -20°C/-80°C

  • Working aliquots can be stored at 4°C for up to one week

Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided. The storage buffer typically consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein integrity .

How does the structure of Ureaplasma urealyticum atpE compare to ATP synthase subunit c in other bacteria?

The ATP synthase subunit c (atpE) in Ureaplasma urealyticum serovar 10 shares the fundamental structural characteristics of bacterial F-type ATPase subunit c proteins but with several unique adaptations:

  • Length: At 109 amino acids, the Ureaplasma atpE is relatively compact compared to other bacterial homologs.

  • Hydrophobicity profile: The protein contains highly hydrophobic regions consistent with its membrane-spanning function, with approximately 60% hydrophobic residues.

  • Conservation: Comparative genomic analyses show that atpE is part of the core genome conserved across all 19 sequenced Ureaplasma strains, belonging to the 515 universally conserved genes .

  • Species-specific adaptations: The protein has evolved to function optimally in the low-pH environment typical of Ureaplasma colonization sites. These adaptations likely influence proton translocation efficiency in the unique metabolic context of these cell wall-less bacteria.

Unlike ATP synthase subunits in many other bacteria, the Ureaplasma variant operates in an organism with extremely limited metabolic capabilities, which lacks a cell wall and has adapted to parasitic lifestyle requiring external nucleotides and sterols .

What techniques are effective for detecting and differentiating Ureaplasma urealyticum serovar 10 in clinical and research samples?

Several complementary approaches are recommended for effective detection and differentiation of Ureaplasma urealyticum serovar 10:

PCR-Based Methods:

  • Serovar-specific PCR using primers targeting the UP063 gene for species identification

  • Real-time quantitative PCR (qPCR) represents the gold standard with sensitivity exceeding 91.98%

  • NAATs (Nucleic Acid Amplification Tests) can detect very small amounts of genetic material but require prior knowledge of target sequences

Culture-Based Methods:

  • MYCO WELL D-ONE culture assay shows 91.98% sensitivity and 96.44% specificity for Ureaplasma detection

  • Culture titration in Ureaplasma-specific medium with pH indicators (typically phenol red) that change from yellow to cerise-red in response to the urea hydrolysis

  • Flow-based culture systems are superior to static methods for biofilm studies, avoiding metabolite-mediated toxicity

Combined Approaches:

  • Metagenomics combined with PCR provides comprehensive detection of all microorganisms in a sample, offering insight into the broader microbial community

  • Whole genome analysis using next-generation sequencing allows definitive serovar identification beyond what antibody-based typing can achieve

The choice of method depends on research objectives, with qPCR recommended for detection, whole genome sequencing for detailed characterization, and culture methods when viable organisms are required for downstream applications.

What genomic regions are most suitable for designing serovar-specific primers to identify Ureaplasma urealyticum serovar 10?

For developing highly specific primers targeting Ureaplasma urealyticum serovar 10, researchers should focus on unique genomic regions identified through comparative genomic analysis:

Optimal Target Criteria:

  • Target genomic regions with <80% identity matches to other Ureaplasma genomes

  • Focus on 25-35bp candidate regions unique to serovar 10

  • For serovar 10, the specificity comes from SPC (Simple Probe Chemistry) probes rather than primers alone

Specific Genomic Target for Serovar 10:
The recommended target for serovar 10-specific detection is a region of the 15,072-bp open reading frame that is almost perfectly conserved (>99.97%) in serovar 10 but sufficiently different in other serovars. The corresponding GenBank ID is ACI60066.1 .

Primer Design Process:

  • Computationally search sequenced genomes to identify candidate regions unique to serovar 10

  • Test each candidate region against all 14 Ureaplasma genomes using BLAST

  • Use design software (e.g., Roche LightCycler Probe Design Software 2.0) to develop primers around these regions

  • Validate primers against all ATCC type strains to confirm specificity

This approach yields highly specific detection capabilities, with fewer than 1 in 20 unique regions ultimately proving suitable for primer development after computational analysis .

What are the advantages and limitations of different culture methods for studying Ureaplasma urealyticum biofilms?

Understanding the advantages and limitations of culture methodologies is crucial for effective Ureaplasma urealyticum biofilm research:

Static Culture Systems:

Advantages:

  • Simpler experimental setup

  • Lower cost and technical requirements

  • Useful for initial screening experiments

Limitations:

  • Accumulation of toxic metabolites

  • Significant drop in cell viability

  • Absence of detectable biofilm formation

  • Poor representation of in vivo conditions

Flow-Based Culture Systems:

Advantages:

  • Sustains long-term development of Ureaplasma biofilms

  • Removes toxic metabolites through continuous medium replacement

  • Enables formation of characteristic sporadic microcolony biofilms

  • Allows visualization of "comet-like tail" appearance similar to other bacteria under flow conditions

  • Better mimics in vivo conditions where flow is present

Limitations:

  • More complex experimental setup

  • Higher technical expertise required

  • Greater equipment costs

Recommended Flow-Based Approach:
The DTU flow cell method allows parallel culture experiments from the same inoculum under both static and flow conditions. This approach facilitates direct comparison and has been shown to be superior for growing Ureaplasma biofilms .

Visualization Methods:

  • Confocal scanning laser microscopy (CSLM) provides high-resolution images of biofilm architecture

  • Scanning electron microscopy offers detailed structural analysis

  • Fluorescent microscopy enables quantification of biomass

For studying Ureaplasma biofilms, flow-based systems are strongly recommended as they overcome the limitations of static systems and enable the characteristic "socially distanced" phenotype of sporadic microcolonies to develop, which may be an adaptive trait to prevent localized toxic metabolite accumulation .

How does the ATP synthase subunit c (atpE) gene vary across different Ureaplasma urealyticum serovars?

The ATP synthase subunit c (atpE) gene shows remarkable conservation across Ureaplasma urealyticum serovars despite significant variation in other genomic regions:

Conservation Level:
The atpE gene is part of the 515 genes in the core genome universally conserved among all 19 sequenced Ureaplasma strains (including all serovars of both U. urealyticum and U. parvum) . This high conservation reflects the essential nature of ATP synthase function for cellular energy metabolism.

Comparative Gene Content:

Species/StrainsPan genomeCore genomeSingletonsClusters of Orthologous Genes (COGs)
All 19 strains1020515262758
14 ATCC serovars971523246725
U. urealyticum (14 strains)938553216722
U. parvum (5 strains)68853877688

The atpE gene belongs to the core genome category (515 genes), highlighting its essential role across all Ureaplasma strains and serovars .

This high conservation makes atpE a potential target for broad-spectrum diagnostic approaches but limits its utility for serovar-specific identification, where other more variable regions must be targeted.

What distinguishes Ureaplasma urealyticum serovar 10 genomically from other serovars?

Ureaplasma urealyticum serovar 10 possesses several distinctive genomic features that differentiate it from other serovars:

Genome Size and Content:

  • Serovar 10 has a genome size between 0.84-0.95 Mbp, typical for U. urealyticum species

  • This is approximately 118 Kbp (13.5%) larger than U. parvum serovars

  • Contains approximately 664 genes, of which around 230 encode hypothetical proteins

Unique Genomic Regions:

  • Serovar 10 contains specific genomic regions with <80% sequence identity to other serovars

  • These regions include the unique 15,072-bp open reading frame (GenBank ID ACI60066.1) that is almost perfectly conserved (>99.97%) in serovar 10

  • Serovar-specific regions primarily encode hypothetical proteins of unknown function

Multiple Banded Antigen (MBA) Variation:

  • The MBA gene system, which encodes the major surface antigen, is part of a phase-variable gene superfamily

  • While some serovars share identical sets of MBA genes, serovar 10 has a distinctive MBA profile

  • This variation in surface antigens likely contributes to serological differences and potentially to tissue tropism and pathogenicity

Genetic Distance:

  • Serovar 10 shows variable genetic distances to other serovars, with inter-species differences averaging 9.5%

  • The greatest genomic difference was observed between U. parvum serovar 1 and U. urealyticum serovar 9 at 10.2%

These genomic distinctions are critical for developing serovar-specific diagnostic tools and understanding potential differences in pathogenicity or antibiotic susceptibility among serovars.

How has the ATP synthase complex evolved in Ureaplasma compared to other Mollicutes?

The ATP synthase complex in Ureaplasma has undergone remarkable evolutionary adaptations compared to other Mollicutes, reflecting their unique metabolism and ecological niche:

Metabolic Context:
Ureaplasma species are unique among Mollicutes in their energy generation mechanism. While other Mollicutes typically utilize arginine or glucose for ATP generation (with Mycoplasma hominis using arginine), Ureaplasma species are distinctive in their utilization of urea hydrolysis to generate ATP . This fundamental metabolic difference has likely driven specific adaptations in their ATP synthase components.

Structural Adaptations:

  • The ATP synthase complex in Ureaplasma has adapted to function in an organism with extremely limited metabolic capabilities

  • As cell wall-less bacteria, the membrane-embedded components like atpE operate in a distinctive lipid environment

  • The proton gradient utilized by ATP synthase in Ureaplasma is generated through a unique mechanism involving urea hydrolysis rather than the typical respiratory chain

Genomic Conservation:
Despite significant genomic reduction typical of parasitic bacteria, Ureaplasma has maintained a complete ATP synthase gene set, underscoring its essential role in cellular energetics. This contrasts with some other Mollicutes that have lost portions of the respiratory chain or ATP synthesis machinery.

Functional Specialization:
The ATP synthase in Ureaplasma has likely evolved specialized features to:

  • Function efficiently in the low pH environment created by urea hydrolysis

  • Operate with the limited energy resources available to these obligate parasites

  • Maintain activity despite the minimalist cellular machinery of these organisms

These evolutionary adaptations make the Ureaplasma ATP synthase an interesting model for studying how essential cellular machinery can be modified to function in highly specialized metabolic contexts.

How can recombinant Ureaplasma urealyticum serovar 10 ATP synthase subunit c be effectively utilized in diagnostic test development?

Recombinant Ureaplasma urealyticum serovar 10 ATP synthase subunit c (atpE) presents several valuable applications for diagnostic test development:

ELISA-Based Diagnostics:

  • The recombinant atpE protein can serve as a capture antigen in enzyme-linked immunosorbent assays

  • This approach enables detection of Ureaplasma-specific antibodies in patient sera

  • The highly purified recombinant protein (>90% purity by SDS-PAGE) ensures specificity and reproducibility

Molecular Standard Development:

  • The recombinant protein can serve as a positive control for PCR-based detection methods

  • Quantified protein standards enable development of calibration curves for quantitative assays

  • Inclusion as external controls in diagnostic kits improves reliability of commercial testing

Antibody Production:

  • The His-tagged recombinant protein facilitates production of high-affinity antibodies

  • These antibodies can be incorporated into rapid lateral flow immunoassays

  • Monoclonal antibodies against conserved epitopes enable broad Ureaplasma detection

Assay Validation Strategies:

Assay TypeSensitivitySpecificityApplication
MYCO WELL D-ONE with recombinant antigen91.98%96.44%Culture-based detection
qPCR targeting atpE>95%>98%Molecular detection
Antibody-based detectionVariableVariableSerological testing

When developing diagnostic tests using recombinant atpE, validation against gold standard qPCR methods is essential, which have demonstrated superior sensitivity and specificity compared to culture-based methods .

What experimental approaches can be used to study the role of ATP synthase in Ureaplasma urealyticum biofilm formation?

Investigating the role of ATP synthase in Ureaplasma urealyticum biofilm formation requires sophisticated experimental approaches:

Flow Cell Methodology:

  • Implement DTU flow cell method to sustain Ureaplasma biofilm development

  • Run parallel cultures under static and flow conditions using the same inoculum

  • This approach overcomes limitations of static systems where toxic metabolite accumulation prevents biofilm formation

Visualization Techniques:

  • Employ confocal scanning laser microscopy to image the characteristic "sporadic microcolony" biofilm morphology

  • Use scanning electron microscopy to examine detailed ultrastructural features

  • Apply fluorescent microscopy with appropriate vital dyes to assess viability within biofilms

Genetic Manipulation Approaches:

  • Develop targeted gene knockdown strategies (RNA interference or antisense oligonucleotides)

  • Apply CRISPR-Cas9 gene editing to create atpE mutants with altered function

  • Introduce site-directed mutations to study specific functional domains

Pharmacological Inhibition:

  • Apply specific ATP synthase inhibitors at sub-MIC concentrations

  • Monitor effects on biofilm initiation, maturation, and dispersal

  • Combine with microscopy to assess structural changes in biofilm architecture

Comparative Studies:

  • Compare biofilm formation between different Ureaplasma serovars with sequence variations in atpE

  • Assess correlation between ATP synthase activity and biofilm structural characteristics

  • Examine biofilm formation under varying pH conditions to probe ATP synthase function

These experimental approaches should be combined with careful controls and quantitative analysis to elucidate the specific contribution of ATP synthase to the distinct "comet-like tail" and "socially distanced" sporadic microcolony phenotype observed in Ureaplasma biofilms .

What considerations are important when designing protein interaction studies involving Ureaplasma urealyticum ATP synthase subunit c?

Designing effective protein interaction studies for Ureaplasma urealyticum ATP synthase subunit c requires careful consideration of its membrane-embedded nature and specialized function:

Protein Solubility Challenges:

  • As a highly hydrophobic membrane protein (evident from its amino acid sequence), atpE requires specialized solubilization protocols

  • Use appropriate detergents (mild non-ionic or zwitterionic) to maintain native structure

  • Consider nanodiscs or amphipols as alternative membrane mimetics to preserve protein-protein interactions

Tag Position Optimization:

  • The standard N-terminal His-tag placement may affect certain interactions

  • Compare N-terminal versus C-terminal tags to identify potential interference

  • Consider cleavable tags to remove potential steric hindrance after purification

Interaction Partner Selection:

  • Include other ATP synthase components (particularly subunits a and b) as primary interaction candidates

  • Investigate membrane proteins involved in proton translocation and energy metabolism

  • Consider unique Ureaplasma proteins that may have co-evolved with their specialized ATP synthase

Methodological Approaches:

  • Pull-down assays using the recombinant His-tagged protein as bait

  • Blue native PAGE to preserve native protein complexes

  • Cross-linking mass spectrometry to capture transient interactions

  • Förster resonance energy transfer (FRET) for in vitro interaction dynamics

  • Bacterial two-hybrid systems modified for membrane protein analysis

Control Considerations:

  • Include non-interacting membrane proteins as negative controls

  • Use ATP synthase subunit c from related but distinct bacterial species as specificity controls

  • Perform competition assays with unlabeled protein to confirm specificity

The unique metabolic context of Ureaplasma urealyticum, which generates ATP through urea hydrolysis rather than typical respiratory chains, suggests that its ATP synthase may have distinctive interaction partners involved in coupling urea metabolism to proton motive force generation.

How might the unique cell wall-less nature of Ureaplasma affect the structure and function of membrane-bound proteins like ATP synthase?

The cell wall-less nature of Ureaplasma creates a distinctive cellular environment that significantly impacts membrane-bound proteins like ATP synthase:

Membrane Composition Effects:

  • Without a cell wall, the cytoplasmic membrane directly interfaces with the external environment

  • Ureaplasma membranes contain sterols (which they cannot synthesize and must acquire from their host), creating a unique lipid environment for membrane proteins

  • This sterol-rich membrane likely alters the hydrophobic matching between ATP synthase subunits and their lipid environment, potentially requiring structural adaptations in transmembrane regions

Structural Stability Considerations:

  • Membrane proteins in Ureaplasma must provide structural integrity typically supported by cell walls in other bacteria

  • The ATP synthase complex may contribute to membrane organization and stability beyond its primary role in energy generation

  • The 109-amino acid atpE protein may contain Ureaplasma-specific adaptations to enhance stability in this cell wall-less context

Protein-Protein Interaction Landscape:

  • The absence of cell wall synthesis machinery creates a different set of membrane protein neighbors

  • ATP synthase in Ureaplasma likely has unique interaction partners related to their specialized urea metabolism

  • The c-ring structure formed by multiple atpE subunits may have adapted to maintain optimal proton translocation in this distinctive membrane environment

Functional Adaptations:

  • ATP synthase must operate in an organism with extremely limited metabolic capabilities

  • The proton gradient utilized by ATP synthase is generated through urea hydrolysis rather than typical respiratory chains

  • The c-subunit has likely evolved to optimize ATP production efficiency in this unique metabolic context

These considerations make Ureaplasma ATP synthase an intriguing model for studying how essential membrane protein complexes adapt to function in minimalist cellular systems and could provide insights relevant to synthetic biology approaches for creating minimal cells.

What role might ATP synthase play in antibiotic resistance mechanisms in Ureaplasma urealyticum?

ATP synthase may contribute to antibiotic resistance in Ureaplasma urealyticum through several direct and indirect mechanisms:

Energy-Dependent Resistance Mechanisms:

  • ATP synthase provides the energy required for active efflux pumps that export antibiotics

  • Enhanced ATP production could support repair mechanisms countering antibiotic-induced damage

  • Energy-dependent adaptation responses require functional ATP synthesis to mount effective resistance

Membrane Potential Maintenance:

  • ATP synthase contributes to maintaining membrane potential

  • Changes in membrane potential can affect uptake of charged antibiotics

  • Modulation of ATP synthase activity may allow adaptation to antibiotic-induced membrane stress

Biofilm Contribution:

  • ATP synthase is likely essential for the energy requirements of biofilm formation

  • Ureaplasma forms distinctive "sporadic microcolony" biofilms with "comet-like tail" structures under flow conditions

  • These biofilms may provide protection against antibiotics through reduced penetration and altered metabolic states

Potential for Direct Modification:

  • Changes in the atpE protein structure could alter binding of antibiotics that directly target ATP synthase

  • Modifications in the c-ring structure might affect membrane properties relevant to antibiotic penetration

  • Single nucleotide polymorphisms in atpE could contribute to resistance phenotypes

Research Approaches:

  • Compare atpE sequences between antibiotic-susceptible and resistant isolates

  • Investigate ATP synthase activity levels in resistant versus susceptible strains

  • Assess the effect of ATP synthase inhibitors on antibiotic efficacy

  • Examine biofilm formation capacity in relation to antibiotic resistance profiles

Understanding these relationships could provide new strategies for combating antibiotic resistance in Ureaplasma infections, potentially through combination therapies targeting both the primary antibiotic target and ATP synthase function.

How can structural biology approaches be applied to study the unique features of Ureaplasma urealyticum ATP synthase subunit c?

Advanced structural biology approaches offer powerful tools for elucidating the unique features of Ureaplasma urealyticum ATP synthase subunit c:

Cryo-Electron Microscopy (Cryo-EM):

  • Enables visualization of the entire ATP synthase complex without crystallization

  • Can reveal the arrangement of multiple atpE subunits in the c-ring structure

  • Allows structural determination in a near-native lipid environment

  • Recommended approach: Single-particle analysis of purified complexes or subtomogram averaging from cellular preparations

X-ray Crystallography:

  • Provides atomic-resolution details of protein structure

  • Challenging for membrane proteins but feasible with appropriate detergent selection

  • May require lipidic cubic phase crystallization methods

  • Most effective for resolving critical residues involved in proton translocation

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Offers insights into protein dynamics not captured by static structures

  • Solid-state NMR particularly suitable for membrane proteins like atpE

  • Can investigate specific protein-lipid interactions critical for function

  • Useful for studying conformational changes during the catalytic cycle

Molecular Dynamics Simulations:

  • Can model atpE behavior in different membrane environments

  • Allows investigation of proton movement through the c-ring

  • Enables comparison with other bacterial ATP synthase c subunits

  • Provides testable hypotheses about functional adaptations

Integrative Structural Biology Workflow:

An integrative approach combining these methods would provide the most comprehensive understanding of how the 109-amino acid atpE protein of Ureaplasma has structurally adapted to its unique cellular environment and metabolic context.

What are the most promising future research directions for Ureaplasma urealyticum ATP synthase subunit c studies?

Several high-potential research directions for Ureaplasma urealyticum ATP synthase subunit c merit further investigation:

1. Structure-Function Relationships:

  • Determine high-resolution structures of the complete ATP synthase complex from Ureaplasma

  • Identify unique structural adaptations that enable function in the sterol-rich, cell wall-less membrane environment

  • Elucidate the molecular mechanism of proton translocation in the context of urea metabolism

2. Biofilm Formation Mechanisms:

  • Investigate the specific role of ATP synthase in the formation of the distinctive "sporadic microcolony" biofilm architecture

  • Determine how energy production via ATP synthase supports the development of the characteristic "comet-like tail" structures under flow conditions

  • Develop targeted approaches to disrupt biofilm formation by modulating ATP synthase activity

3. Therapeutic Target Development:

  • Explore ATP synthase as a potential drug target, leveraging its essential role in cellular energetics

  • Identify specific inhibitors that selectively target Ureaplasma ATP synthase over human homologs

  • Evaluate combination therapies targeting both ATP synthesis and other cellular processes

4. Evolutionary Adaptations:

  • Perform comparative analyses across all 14 serovars to identify selective pressures on atpE

  • Reconstruct the evolutionary trajectory of ATP synthase adaptation to the Ureaplasma lifestyle

  • Use synthetic biology approaches to test hypotheses about functional adaptations

5. Host-Pathogen Interactions:

  • Investigate whether ATP synthase components are exposed on the cell surface in this cell wall-less organism

  • Determine if host immune responses target ATP synthase during infection

  • Explore potential moonlighting functions of ATP synthase subunits in host cell adherence or invasion

These research directions could significantly advance our understanding of both basic bacterial physiology and potential therapeutic approaches for Ureaplasma infections, which have been implicated in nongonococcal urethritis, infertility, adverse pregnancy outcomes, and bronchopulmonary dysplasia in neonates .

What methodological advances would most benefit research on Ureaplasma urealyticum ATP synthase?

Several methodological advances would substantially accelerate research on Ureaplasma urealyticum ATP synthase:

Genetic Manipulation Systems:

  • Development of reliable transformation protocols for Ureaplasma species

  • CRISPR-Cas9 adaptation for efficient genome editing in these minimal genome organisms

  • Inducible gene expression systems to control ATP synthase component production

  • Site-directed mutagenesis approaches optimized for the high A-T content genome

Advanced Imaging Technologies:

  • Super-resolution microscopy methods to visualize ATP synthase distribution in intact cells

  • Real-time ATP imaging in living Ureaplasma to correlate synthase activity with cellular processes

  • Correlative light and electron microscopy to link function with ultrastructure

  • Advanced biofilm imaging technologies compatible with flow cell systems

Biochemical Assays:

  • Native membrane preparation techniques that preserve ATP synthase activity

  • High-throughput ATP synthesis assays in native-like membrane environments

  • Reconstitution systems to study purified ATP synthase in defined lipid compositions

  • Fluorescence-based assays to monitor proton translocation in real-time

Computational Tools:

  • Improved homology modeling algorithms for highly divergent membrane proteins

  • Machine learning approaches to predict protein-protein interactions specific to Ureaplasma

  • Molecular dynamics simulations optimized for the unique membrane environment

  • Systems biology models integrating ATP synthesis with the minimal Ureaplasma metabolic network

Cell Culture Systems:

  • Refined flow-based culture systems that better mimic in vivo conditions

  • Co-culture models to study ATP synthase function during host cell interaction

  • Microfluidic systems for single-cell analysis of ATP production

  • Long-term culture systems that maintain Ureaplasma viability without biofilm formation

These methodological advances would overcome current technical barriers and enable more sophisticated investigation of this essential enzyme complex in a medically relevant but experimentally challenging microorganism.

How might findings from Ureaplasma ATP synthase research translate to other minimal genome organisms?

Research on Ureaplasma urealyticum ATP synthase offers valuable insights applicable to other minimal genome organisms and synthetic biology:

Principles of Energetic Efficiency:

  • Ureaplasma has evolved highly efficient energy production systems despite genome reduction

  • Understanding these adaptations could inform design principles for minimal synthetic cells

  • Insights from atpE structure could reveal how energy production can be optimized in resource-limited conditions

Membrane Protein Adaptation:

  • ATP synthase adaptation to the cell wall-less environment provides a model for membrane protein function in minimal cells

  • Principles learned could apply to other Mollicutes and wall-less bacteria

  • Could inform design of membrane proteins for artificial cell systems with non-standard membranes

Biofilm Formation in Minimal Organisms:

  • The distinctive "sporadic microcolony" biofilm architecture may represent adaptations to minimal cellular machinery

  • Understanding how limited proteomes support complex multicellular behaviors has broad implications

  • Could reveal essential components required for biofilm formation across diverse species

Drug Development Templates:

  • ATP synthase adaptations in Ureaplasma could reveal targetable features in other minimal pathogens

  • Structural differences from human ATP synthase could inform selective inhibitor design

  • Combination therapy approaches targeting energy production might be applicable to other difficult-to-treat minimal genome pathogens

Evolutionary Insights:

  • ATP synthase conservation despite extensive genome reduction highlights essential functions

  • Comparing adaptations across minimal organisms could reveal convergent evolutionary strategies

  • May help reconstruct the evolutionary trajectory of genome reduction in diverse lineages

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.