Recombinant Ureaplasma urealyticum serovar 10 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzyme Classification and Functional Role

Glycerol-3-phosphate acyltransferase (PlsY) belongs to the acyltransferase family and is encoded by the plsY gene (gene identifier: UUR10_0448) in Ureaplasma urealyticum serovar 10 . Its primary role involves:

  • Catalyzing the committed step in phospholipid biosynthesis .

  • Converting acyl-phosphate and G3P into lysophosphatidic acid, a precursor for membrane lipids .

  • Contributing to bacterial membrane integrity, a potential virulence factor in pathogenic species .

Role in Bacterial Pathogenicity

  • PlsY is indispensable for membrane biogenesis in Ureaplasma spp., which colonize the human urogenital tract and are linked to preterm birth and neonatal infections .

  • Inhibition of PlsY activity could disrupt bacterial membrane synthesis, offering a therapeutic target .

Host-Pathogen Interactions

  • Ureaplasma spp. modulate host immune responses via secreted proteases and lipases . While PlsY itself is not directly implicated in immune evasion, its role in membrane lipid synthesis may influence bacterial survival in hostile host environments .

Future Directions

  • Structural characterization: High-resolution crystallography of U. urealyticum PlsY is needed to elucidate species-specific mechanisms.

  • Drug development: Screening for PlsY inhibitors could yield novel antimicrobials, particularly against antibiotic-resistant Ureaplasma strains .

  • Pathogenicity studies: Investigating PlsY knockout mutants may clarify its role in Ureaplasma-associated diseases like chorioamnionitis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be established during the production process. If you have a preferred tag type, please inform us, and we will prioritize its development accordingly.
Synonyms
plsY; UUR10_0448; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Target Names
plsY
Target Protein Sequence
MDQVYSVAMAYILTLIISPLYSYLIGSLNASIILSLLLKKQDIRHFASKNAGMTNMTRVY GKKLGILTLFLDIVKPIITISLTYIIYKYALNAPFVLSNGFNQAILVYFGGIFTIIGHCY PIFFKFQGGKGVASYGGFLITIDPIVAVIGIITLLIILLITKYMSLSAMITATITCFLVL IPGINYIPYYNEHFVEYLFDLNHVIKGTWYVWLFLLISASILIYRHKTNILSIATKQERK TFLFQPKPKNNI
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). Notably, it utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant Ureaplasma urealyticum serovar 10 plsY?

Expression of recombinant Ureaplasma urealyticum serovar 10 plsY is typically achieved using Escherichia coli expression systems. For membrane proteins like plsY, optimization of soluble expression is critical. Based on similar recombinant protein expression studies, a multivariate experimental design approach is recommended to optimize expression conditions. This includes:

  • Selection of appropriate E. coli strains (BL21(DE3), Rosetta, or C41/C43 for membrane proteins)

  • Optimization of induction parameters (IPTG concentration, induction temperature, duration)

  • Media composition adjustments to enhance soluble expression

Statistical experimental design methodologies have proven effective for optimizing recombinant protein expression by evaluating multiple variables simultaneously, rather than the traditional one-variable-at-a-time approach. This multivariate method allows characterization of experimental error, comparison of variable effects, and gathering high-quality information with fewer experiments .

How can researchers accurately identify and distinguish Ureaplasma urealyticum serovar 10 from other serovars?

Accurate identification and distinction of Ureaplasma urealyticum serovar 10 from other serovars requires a combination of molecular techniques:

  • Initial species-level classification using multiplex species-specific real-time PCR assays to differentiate between U. parvum and U. urealyticum

  • Subsequent serovar typing using serovar-specific real-time PCR assays with appropriate controls:

    • ATCC type strain as positive control

    • Distilled water as negative control

  • For untypeable isolates, secondary PCR assays targeting the urease gene can be performed

  • For isolates containing multiple serovars, quantification using standard curves generated from a universal control plasmid (such as pUC19-U carrying serovar markers) is recommended

  • DNA sequencing of specific gene regions for confirmation, particularly when PCR results are ambiguous

For definitive identification of complex or ambiguous cases, whole genome sequencing using platforms such as 454 pyrosequencing followed by assembly with Newbler Assembler and comparative analysis with reference genomes through dot plot generation is recommended .

What experimental design approaches are most effective for optimizing the soluble expression of recombinant Ureaplasma urealyticum serovar 10 plsY?

For optimizing soluble expression of recombinant Ureaplasma urealyticum serovar 10 plsY, a factorial design approach is most effective. This statistical technique allows researchers to identify significant variables affecting expression and develop optimal conditions with fewer experiments and minimal resources.

A fractional factorial screening design is recommended, typically using 2^(8-4) (two levels for each of eight variables) with central point replicates. The key variables to evaluate include:

  • Media composition factors:

    • Carbon source concentration

    • Nitrogen source concentration

    • Trace element composition

    • Salt concentration

  • Induction conditions:

    • Inducer concentration (e.g., IPTG)

    • Induction temperature

    • Cell density at induction (OD600)

    • Induction duration

Responses to measure include cell growth, biological activity, and productivity. Based on similar studies with membrane proteins, induction times between 4-6 hours typically yield optimal results, with longer inductions often associated with lower productivity due to protein aggregation or toxicity .

The experimental design matrix would typically look like:

ExperimentCarbon Source (g/L)Nitrogen Source (g/L)Induction Temperature (°C)IPTG (mM)OD600 at InductionInduction Time (h)Salt Concentration (g/L)Trace Elements
1LowLowLowLowLowLowLowLow
2HighLowLowLowHighLowHighLow
...........................
16HighHighHighHighHighHighHighHigh
C1-C3MidMidMidMidMidMidMidMid

This approach can increase soluble expression yields to 200-250 mg/L compared to non-optimized conditions that might yield only 20-50 mg/L of soluble protein .

How can researchers address the antigenic variation in Ureaplasma urealyticum plsY when developing diagnostic assays?

Addressing antigenic variation in Ureaplasma urealyticum plsY for diagnostic assay development requires a multi-faceted approach:

  • Epitope Mapping: Identify conserved and variable epitopes within the plsY protein across different serovars. This can be accomplished through:

    • Computational analysis of sequence alignments

    • Experimental mapping using antibody binding studies

    • Peptide array screening

  • Recombinant Antigen Development: Similar to approaches used for Ureaplasma parvum multiple banded antigen (MBA), researchers should:

    • Amplify the plsY gene by PCR with primers flanking key epitope regions

    • Clone into an appropriate expression vector (e.g., pTrcHis TOPO plasmid)

    • Purify recombinant proteins

    • Evaluate in Western blotting and ELISA with:

      • Serotype-specific monoclonal antibodies

      • Human sera from different patient populations

  • Cross-Reactivity Assessment: Test recombinant plsY against antibodies from all Ureaplasma serovars to identify:

    • Serotype-specific reactions

    • Cross-reactive regions

When developing serotype-specific assays, it's important to recognize that plsY contains both serotype-specific and non-serotype-specific epitopes. This characteristic can be advantageous for diagnostic assay development but requires careful validation to ensure specificity .

What are the optimal purification strategies for maintaining the structural integrity and function of recombinant Ureaplasma urealyticum serovar 10 plsY?

Purification of membrane-associated proteins like Ureaplasma urealyticum serovar 10 plsY requires careful optimization to maintain structural integrity and function. Based on similar studies with recombinant proteins, the following purification strategy is recommended:

  • Cell Lysis and Initial Extraction:

    • Mechanical disruption (sonication or high-pressure homogenization)

    • Buffer composition: Tris-based buffer (50 mM, pH 7.5-8.0) with glycerol (10-20%)

    • Addition of appropriate detergents for membrane protein solubilization:

      • Non-ionic detergents (n-dodecyl-β-D-maltoside or Triton X-100)

      • Zwitterionic detergents (CHAPS or lauryldimethylamine oxide)

  • Chromatographic Purification:

    • Immobilized Metal Affinity Chromatography (IMAC) for His-tagged proteins

    • Size Exclusion Chromatography for further purification and detergent exchange

    • Ion Exchange Chromatography as a polishing step

  • Protein Stabilization:

    • Storage in Tris-based buffer with 50% glycerol as used for commercial preparations

    • Storage temperature at -20°C for short-term or -80°C for extended storage

    • Aliquoting to avoid repeated freeze-thaw cycles

  • Activity Assessment:

    • Enzymatic activity assays to confirm functional integrity

    • Structural characterization via circular dichroism or thermal shift assays

Optimized purification protocols typically yield protein with approximately 75% homogeneity while maintaining functional activity. For membrane proteins like plsY, the critical challenge is maintaining the native conformation during solubilization and purification steps .

How does horizontal gene transfer affect the genetic diversity of plsY among clinical isolates of Ureaplasma urealyticum?

Horizontal gene transfer (HGT) plays a significant role in the genetic diversity of plsY among clinical isolates of Ureaplasma urealyticum. Based on genomic studies of Ureaplasma species, several key patterns have been observed:

  • Hybrid Strains and Mixed Cultures:

    • Clinical isolates often contain multiple serovars

    • Quantitative PCR analysis can help distinguish between:

      • True hybrids (≤5-fold difference in serovar markers)

      • Hybrid/mixture cases (5-10 fold difference)

      • Mixed cultures (>10-fold difference)

  • Gene Mosaic Structures:

    • Whole genome sequencing of untypeable clinical isolates reveals gene mosaics

    • These structures result from recombination events between different serovars

    • plsY and other metabolic genes can be affected by these recombination events

  • Implications for Typing and Diagnostics:

    • Traditional serotyping methods may fail to identify hybrid strains

    • Whole genome sequencing approaches are recommended for accurate characterization

    • Comparison to reference genomes through dot plot analysis helps identify recombination points

For researchers studying plsY diversity, it's essential to consider that apparent contradictions in typing results may actually reflect natural horizontal gene transfer events rather than laboratory errors. This genetic plasticity contributes to the adaptability of Ureaplasma species and may influence pathogenicity, host adaptation, and antimicrobial resistance .

What experimental design approaches should be used to optimize recombinant plsY protein yield while maintaining functional activity?

To optimize recombinant plsY protein yield while maintaining functional activity, a systematic experimental design approach is recommended:

  • Factorial Design Implementation:

    • Use a 2^k factorial design or fractional factorial design to screen multiple variables

    • Include central points to estimate experimental error

    • Apply response surface methodology (RSM) for further optimization of significant factors

  • Key Variables to Optimize:

    CategoryVariables
    Strain SelectionBL21(DE3), Rosetta, C41/C43, SHuffle
    Vector DesignPromoter strength, Fusion tags, Codon optimization
    Growth ConditionsTemperature, Media composition, Aeration
    Induction ParametersInducer concentration, OD600 at induction, Duration
    Post-induction EnvironmentTemperature reduction, Osmotic pressure, Chaperone co-expression
  • Response Measurement:

    • Total protein yield (mg/L)

    • Soluble fraction percentage

    • Specific enzymatic activity

    • Structural integrity assessment

  • Statistical Analysis:

    • ANOVA to determine statistically significant variables

    • Interaction effects analysis

    • Prediction model development

    • Confirmation runs to validate optimization

This approach has been successful in achieving high levels (250 mg/L) of soluble expression of recombinant proteins in E. coli with maintained functional activity. For membrane proteins like plsY, optimization of solubilization conditions is particularly important .

How can researchers develop a serological assay using recombinant Ureaplasma urealyticum serovar 10 plsY for clinical research?

Developing a serological assay using recombinant Ureaplasma urealyticum serovar 10 plsY requires careful consideration of several factors:

  • Recombinant Antigen Preparation:

    • Amplify plsY gene from reference strains using PCR

    • Clone into an appropriate expression vector (e.g., pTrcHis TOPO)

    • Express and purify recombinant protein maintaining native epitopes

    • Validate protein integrity through Western blotting

  • Assay Format Selection:

    • ELISA is typically recommended for serological testing

    • Western blotting for confirmation and epitope analysis

    • Multiplex bead-based assays for testing against multiple antigens

  • Optimization Protocol:

    • Antigen coating concentration (typically 1-10 μg/mL)

    • Blocking conditions to minimize background

    • Sample dilution series (1:50 to 1:1000)

    • Secondary antibody selection and dilution

    • Incubation times and temperatures

  • Validation Strategy:

    • Test with serotype-specific monoclonal antibodies

    • Evaluate cross-reactivity with other Ureaplasma serovars

    • Test with characterized patient sera panels:

      • Positive cases with known infection

      • Negative controls

      • Cases with other microbial infections to assess specificity

  • Performance Assessment:

    ParameterTarget ValueMethod
    Sensitivity>90%Testing known positive samples
    Specificity>95%Testing known negative samples
    ReproducibilityCV <15%Intra- and inter-assay testing
    Cross-reactivity<5%Testing against other microorganisms
    Stability>6 monthsAccelerated and real-time testing

Similar approaches have been successfully employed for developing serological assays using recombinant antigens of Ureaplasma parvum serotypes, achieving good discrimination between serotypes while maintaining sensitivity .

What are the recommended approaches for studying the enzymatic function of recombinant plsY and its role in Ureaplasma membrane phospholipid synthesis?

Studying the enzymatic function of recombinant plsY and its role in Ureaplasma membrane phospholipid synthesis requires specialized methodologies:

  • Enzymatic Activity Assays:

    • Radiometric assays using [14C]-labeled substrates to track acyl transfer

    • Spectrophotometric coupled assays measuring product formation

    • HPLC-based methods to analyze reaction products

  • Substrate Specificity Analysis:

    • Test various acyl-ACP and acyl-CoA donors

    • Analyze glycerol-3-phosphate analog incorporation

    • Determine kinetic parameters (Km, Vmax, kcat) for different substrates

  • Structure-Function Analysis:

    • Site-directed mutagenesis of conserved residues

    • Deletion analysis of protein domains

    • Chimeric protein construction with related enzymes

  • Membrane Integration Studies:

    • Fluorescence-based membrane association assays

    • Liposome reconstitution experiments

    • In vivo complementation in bacterial models

  • Inhibition Studies:

    • Screening of potential inhibitors

    • Mechanism of inhibition analysis

    • Structure-activity relationship studies

  • Phospholipid Profile Analysis:

    • Liquid chromatography-mass spectrometry (LC-MS) of cellular lipids

    • Thin-layer chromatography with radiometric detection

    • Stable isotope labeling to track metabolic flux

How can researchers address challenges in expressing soluble and functional Ureaplasma urealyticum serovar 10 plsY in heterologous systems?

Addressing challenges in the expression of soluble and functional Ureaplasma urealyticum serovar 10 plsY requires systematic troubleshooting approaches:

  • Common Challenges and Solutions:

    ChallengePotential Solutions
    Inclusion body formation- Lower induction temperature (16-25°C)
    - Reduce inducer concentration
    - Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)
    - Use solubility-enhancing fusion partners (SUMO, MBP, TrxA)
    Protein toxicity- Use tightly regulated expression systems
    - Employ specialized host strains (C41/C43)
    - Optimize codon usage for heterologous expression
    Low yield- Optimize media composition using DoE approaches
    - Adjust harvest timing
    - Scale up cultivation volume
    - Consider alternative promoters
    Loss of activity- Include appropriate cofactors in purification buffers
    - Optimize detergent selection for membrane proteins
    - Use mild purification conditions
    - Validate proper folding using spectroscopic methods
  • Experimental Design Approach:

    • Apply fractional factorial design to systematically test multiple variables

    • Measure multiple responses (growth, protein yield, solubility, activity)

    • Generate mathematical models to predict optimal conditions

    • Perform validation experiments under optimized conditions

  • Advanced Expression Strategies:

    • Cell-free protein synthesis for toxic proteins

    • Periplasmic expression to facilitate disulfide bond formation

    • Baculovirus expression for complex membrane proteins

    • Codon harmonization rather than simple codon optimization

These approaches have successfully addressed similar challenges in recombinant protein expression, achieving high yields (250 mg/L) of soluble, active recombinant proteins with approximately 75% homogeneity .

What strategies can researchers employ when facing difficulties in distinguishing between Ureaplasma urealyticum serovars in clinical isolates?

When researchers face difficulties distinguishing between Ureaplasma urealyticum serovars in clinical isolates, several advanced strategies can be employed:

  • Enhanced Molecular Typing:

    • Multiplex real-time PCR assays targeting multiple genetic markers

    • Digital PCR for absolute quantification of different serovars

    • Next-generation sequencing approaches for comprehensive genetic analysis

  • Quantitative Analysis for Mixed Cultures:

    • Construct standard curves using control plasmids containing serovar markers

    • Establish quantitative cut-offs for classification:

      • ≤5-fold difference: hybrid strain

      • 5-10 fold difference: hybrid/mixture

      • 10-fold difference: mixed culture

  • Alternative Genetic Markers:

    • Target multiple genes beyond traditional markers:

      • Urease gene cluster

      • Multiple banded antigen (MBA) genes

      • Housekeeping genes for multilocus sequence typing (MLST)

  • Whole Genome Approaches:

    • 454 pyrosequencing or other next-generation sequencing methods

    • Genome assembly using specialized software (e.g., Newbler Assembler)

    • Comparative genomics through dot plot analysis with reference genomes

    • SNP analysis for fine discrimination between closely related strains

  • Cultivation Techniques:

    • Selective media formulations

    • Serial dilution and colony isolation

    • Immunomagnetic separation with serovar-specific antibodies

The combination of these approaches can resolve most typing challenges, particularly when dealing with hybrid strains resulting from horizontal gene transfer, which are common in clinical Ureaplasma isolates .

How can recombinant Ureaplasma urealyticum serovar 10 plsY contribute to understanding antimicrobial resistance mechanisms?

Recombinant Ureaplasma urealyticum serovar 10 plsY can significantly contribute to understanding antimicrobial resistance mechanisms through several research applications:

  • Target-Based Screening:

    • Establish in vitro enzyme assays using purified recombinant plsY

    • Screen potential inhibitors targeting phospholipid biosynthesis

    • Identify compounds that specifically inhibit plsY activity

  • Mechanism Studies:

    • Investigate the role of membrane composition in antimicrobial resistance

    • Examine how alterations in phospholipid synthesis affect:

      • Membrane permeability

      • Drug efflux pump function

      • Cell wall synthesis and integrity

  • Genetic Manipulation Approaches:

    • Express recombinant plsY variants containing clinically observed mutations

    • Assess the impact of these mutations on:

      • Enzymatic activity

      • Inhibitor binding

      • Membrane composition

  • Structure-Function Analysis:

    • Determine crystal structures of recombinant plsY alone and with inhibitors

    • Identify binding pockets and critical residues for inhibitor interaction

    • Guide rational design of new antimicrobials targeting plsY

  • Resistance Development Studies:

    • Expose Ureaplasma to sub-inhibitory concentrations of plsY inhibitors

    • Sequence plsY gene from resulting resistant mutants

    • Express recombinant versions of mutant proteins to confirm resistance mechanisms

This approach is particularly valuable given the limited treatment options for Ureaplasma infections and increasing antibiotic resistance concerns. Understanding the structural and functional aspects of plsY can facilitate the development of novel antimicrobials targeting this essential pathway .

What is the significance of comparative genomic analysis of plsY across different Ureaplasma serovars for understanding pathogenicity?

Comparative genomic analysis of plsY across different Ureaplasma serovars provides crucial insights into pathogenicity mechanisms:

  • Evolutionary Conservation Analysis:

    • Sequence comparison of plsY across all 14 Ureaplasma serovars

    • Identification of highly conserved regions suggesting essential functions

    • Detection of variable regions that may relate to serovar-specific virulence

  • Horizontal Gene Transfer Assessment:

    • Analysis of genetic recombination patterns affecting plsY

    • Identification of mosaic gene structures indicating horizontal exchange

    • Correlation of specific recombination events with altered pathogenicity

  • Structure-Function Correlations:

    • Mapping of amino acid variations to protein functional domains

    • Prediction of effects on enzyme activity and substrate specificity

    • Correlation with clinical outcomes or disease associations

  • Host Adaptation Signatures:

    • Analysis of selection pressure on plsY across different host environments

    • Identification of adaptive mutations in clinical isolates

    • Correlation with tissue tropism and colonization efficiency

  • Phylogenetic Analysis:

    • Construction of evolutionary trees based on plsY sequences

    • Comparison with trees based on other genetic markers

    • Assessment of whether plsY evolution correlates with pathogenicity clusters

This comparative approach can help resolve the long-standing question of whether pathogenicity in Ureaplasma is serotype-specific or determined by other genetic factors. The etiology is likely multifactorial, involving patient immunity, strain type, and antigen variation, but detailed genetic analysis of essential genes like plsY can provide important pieces of this complex puzzle .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.