Recombinant Urocyon cinereoargenteus Cytochrome c oxidase subunit 2 (MT-CO2)
Shipped with Ice Packs 
In Stock 
Description
Functional Role in Mitochondrial Respiration
As subunit 2 of cytochrome c oxidase (Complex IV), recombinant MT-CO2 demonstrates:
-
Electron transfer capability: Mediates electron shuttling via its CuA center to the heme-copper binuclear site in subunit 1 .
-
Oxygen reduction: Catalyzes the four-electron reduction of O₂ to H₂O, critical for ATP synthesis .
-
Structural interactions: Binds cytochrome c through conserved lysine and glutamate residues (e.g., E129, D132) .
Functional assays show the recombinant protein maintains 80-90% activity compared to native isoforms when reconstituted into liposomes .
Research Applications
The recombinant MT-CO2 protein has been utilized in multiple experimental systems:
A commercial IHC kit (Proteintech KHC0575) using this recombinant protein demonstrates cross-reactivity with human, mouse, and rat tissues, enabling comparative mitochondrial studies .
Clinical and Research Implications
Recent studies using recombinant MT-CO2 have revealed:
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Urocyon cinereoargenteus (Gray fox)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS
YMIPTQELKPGELRLLEVDNRVVLPMEMTVRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLMAMRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETWSALMV
Uniprot No.
Target Background
Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the Cu(A) center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and Cu(B). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
