Recombinant Urotrichus talpoides NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Introduction to MT-ND4L and Its Role

MT-ND4L encodes a subunit of NADH dehydrogenase (Complex I), a critical component of the mitochondrial electron transport chain. In Urotrichus talpoides (Japanese shrew mole), this protein facilitates electron transfer from NADH to ubiquinone, enabling ATP synthesis via oxidative phosphorylation . The recombinant version is engineered for research, including structural studies, biochemical assays, and diagnostic applications .

Species-Specific Attributes

AttributeDetail
SpeciesUrotrichus talpoides (Japanese shrew mole)
GeneMT-ND4L (mitochondrially encoded)
Uniprot IDQ7Y8D5
Protein Length98 amino acids (partial sequence available)
Molecular Weight~11 kDa (inferred from human homolog)

Expression Systems

Recombinant MT-ND4L is produced in E. coli, yeast, baculovirus, or mammalian cell systems . The choice of host depends on post-translational modification requirements.

Functional Role

MT-ND4L contributes to the core transmembrane structure of Complex I, facilitating proton translocation across the mitochondrial inner membrane . Mutations in this gene are linked to metabolic disorders in humans, though analogous studies in U. talpoides remain limited .

Biochemical Assays

  • ELISA Kits: Recombinant MT-ND4L is used as an antigen to detect specific antibodies, aiding in immunological studies .

  • Protein Interactions: Studies investigate interactions with other Complex I subunits (e.g., ND1, ND2) using co-expression systems .

Phylogenetic Insights

Mitochondrial genome comparisons in Talpidae reveal:

  • Start Codons: U. talpoides uses ATG for ND4L, aligning with most Talpidae species .

  • Sequence Conservation: High variability in ND4L across shrew moles suggests functional divergence in Complex I .

Research Gaps and Future Directions

  1. Functional Studies: Limited data on U. talpoides MT-ND4L’s role in metabolic pathways.

  2. Comparative Models: Potential as a model for studying mitochondrial diseases in non-human mammals .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag during production.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Urotrichus talpoides (Japanese shrew mole)
Target Names
Target Protein Sequence
MSLVYVNVMIAFLISLLGLLMYRSHLMSSLLCLEGMMLSLFILGTIMILNIHFTLASMIP IILLVFAACEAAIGLSLLVMVSNTYGVDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its primary function in mitochondria?

MT-ND4L (mitochondrially encoded NADH:ubiquinone oxidoreductase chain 4L) is a protein-coding gene that provides instructions for making NADH dehydrogenase 4L, which functions as a critical component of the mitochondrial respiratory Complex I (NADH:ubiquinone oxidoreductase) . This protein is embedded in the inner mitochondrial membrane and participates in the first step of the electron transport chain during oxidative phosphorylation .

Specifically, MT-ND4L contributes to the complex that transfers electrons from NADH to ubiquinone, a process that establishes the electrochemical gradient necessary for ATP production . The protein is part of the hydrophobic protein fragment of Complex I, which appears to consist of 41 subunits in humans . Its role in energy metabolism is fundamental to cellular function, particularly in tissues with high energy demands.

How does MT-ND4L contribute to the electron transport chain and oxidative phosphorylation?

MT-ND4L functions as an integral component of Complex I, which is responsible for the initial step in the electron transport process during oxidative phosphorylation . The process involves:

  • Transfer of electrons from NADH to ubiquinone through Complex I

  • Creation of an unequal electrical charge across the inner mitochondrial membrane

  • Utilization of this electrochemical gradient for ATP synthesis

As part of Complex I, MT-ND4L contributes to the proton-pumping mechanism that translocates protons from the mitochondrial matrix to the intermembrane space . This proton translocation is coupled to the electron transfer from NADH to ubiquinone, creating the proton motive force that drives ATP synthase to produce ATP .

The specific role of MT-ND4L within this process appears to involve the hydrophobic domain of Complex I, which is critical for maintaining the structural integrity necessary for efficient electron transfer and proton translocation .

What experimental approaches are most effective for studying MT-ND4L function in mitochondrial diseases?

Researchers employ several sophisticated experimental approaches to investigate MT-ND4L function in mitochondrial diseases:

  • Genetic sequencing: Whole exome sequencing (WES) with specialized pipelines for accurate assembly and variant calling in mitochondrial genomes, as demonstrated in the Alzheimer's Disease Sequencing Project (ADSP) that analyzed 10,831 participants .

  • Functional assays: Measurement of Complex I activity through spectrophotometric assays that assess NADH:ubiquinone oxidoreductase activity in isolated mitochondria or tissue samples.

  • Immunological techniques: Utilization of specific antibodies like the polyclonal antibody PA5-75197, which is affinity-purified from rabbit antiserum with >95% purity (by SDS-PAGE) .

  • Recombinant protein studies: Expression and purification of recombinant MT-ND4L for structural and functional analyses, available in preparations such as the 50 μg volume mentioned in search results .

  • Gene-based statistical tests: Application of methods such as SKAT-O for gene-based tests and the SCORE test for variant association studies, as employed in research connecting MT-ND4L variants with Alzheimer's disease .

These approaches allow researchers to connect genetic variations in MT-ND4L with functional consequences at the molecular, cellular, and physiological levels.

How do mutations in MT-ND4L affect Complex I activity and what are the downstream metabolic consequences?

Mutations in MT-ND4L can significantly disrupt Complex I activity with cascading effects on cellular metabolism:

The T10663C (Val65Ala) mutation identified in families with LHON represents a specific example where a single amino acid change in MT-ND4L leads to visual impairment . Similarly, the rs28709356 C>T variant has been associated with increased risk of Alzheimer's disease (P = 7.3 × 10−5), suggesting that MT-ND4L dysfunction may contribute to neurodegenerative processes .

What is the evidence linking MT-ND4L variants to neurodegenerative diseases like Alzheimer's?

Research has established significant connections between MT-ND4L variants and neurodegenerative diseases, particularly Alzheimer's disease (AD):

  • Study-wide significant association: A rare MT-ND4L variant (rs28709356 C>T, minor allele frequency = 0.002) showed significant association with AD risk (P = 7.3 × 10−5) in a comprehensive analysis of 4,220 mtDNA variants from 10,831 participants in the Alzheimer's Disease Sequencing Project .

  • Gene-based test confirmation: The association was further supported by a gene-based test using SKAT-O, which confirmed MT-ND4L's significant association with AD (P = 6.71 × 10−5) .

  • Mitochondrial-nuclear gene interactions: The same study identified a significant association between AD and TAMM41, a nuclear gene related to mitochondrial function, suggesting a broader mitochondrial involvement in AD pathogenesis .

  • Expression differences: Complementary research has shown expression differences in mitochondrial genes between AD cases and controls, supporting the hypothesis that mitochondrial dysfunction contributes to AD pathology .

These findings collectively provide compelling evidence for the role of mitochondria, specifically MT-ND4L, in AD, suggesting that mitochondrial dysfunction may represent an important pathogenic mechanism in neurodegenerative diseases.

What methodological challenges exist in studying recombinant MT-ND4L and how can researchers overcome them?

Studying recombinant MT-ND4L presents several methodological challenges:

  • Protein hydrophobicity: The highly hydrophobic nature of MT-ND4L makes expression, purification, and handling difficult. Researchers can address this by using specialized detergents or lipid environments during purification and storage in optimized buffers with 50% glycerol as noted in commercial preparations .

  • Structural integrity: Maintaining the native conformation of recombinant MT-ND4L outside its natural membrane environment is challenging. This can be mitigated by reconstitution into liposomes or nanodiscs that mimic the native lipid environment.

  • Functional assessment: Evaluating the function of isolated MT-ND4L is difficult because it normally operates as part of Complex I. Researchers can overcome this by co-expressing MT-ND4L with other Complex I components or developing specialized activity assays.

  • Storage stability: Recombinant MT-ND4L may have limited stability during storage. This can be addressed by following storage recommendations such as maintaining the protein at -20°C or -80°C for extended storage and avoiding repeated freeze-thaw cycles .

  • Species differences: When using recombinant Urotrichus talpoides MT-ND4L as a model for human studies, researchers must account for species differences. Careful sequence alignment and functional validation are necessary to ensure relevance to human biology.

How can researchers effectively use recombinant MT-ND4L in experimental studies?

Researchers can utilize recombinant MT-ND4L in various experimental applications:

  • Structural studies: Recombinant MT-ND4L can be used for X-ray crystallography, cryo-electron microscopy, or NMR studies to elucidate the protein's structure and its interactions within Complex I.

  • Interaction analyses: The recombinant protein enables studies of molecular interactions with other Complex I components, membrane lipids, or potential therapeutic compounds through techniques such as pull-down assays, surface plasmon resonance, or isothermal titration calorimetry.

  • Antibody validation: Recombinant MT-ND4L serves as a positive control for validating antibodies used in immunological studies, ensuring specificity before application to biological samples .

  • Functional reconstitution: Researchers can incorporate recombinant MT-ND4L into artificial membrane systems to study its contribution to electron transport or proton pumping activities.

  • Mutation studies: Site-directed mutagenesis of recombinant MT-ND4L allows for systematic evaluation of how specific amino acid changes (such as those identified in disease states) affect protein function.

When working with recombinant MT-ND4L, researchers should maintain the protein in Tris-based buffer with 50% glycerol as specified in product information and aliquot the protein to avoid repeated freeze-thaw cycles, storing working aliquots at 4°C for up to one week .

What antibody-based techniques are most useful for MT-ND4L research?

Several antibody-based techniques have proven valuable for MT-ND4L research:

  • Western blotting: This technique allows for semi-quantitative assessment of MT-ND4L protein levels in tissue or cell samples, using antibodies such as the polyclonal antibody PA5-75197, which is affinity-purified with >95% purity (by SDS-PAGE) .

  • Immunohistochemistry/Immunocytochemistry: These methods enable visualization of MT-ND4L distribution within tissues or cells, providing insights into its localization patterns in normal versus diseased states.

  • Immunoprecipitation: This technique can isolate MT-ND4L and its interaction partners from complex biological samples, facilitating the study of protein-protein interactions within Complex I.

  • Flow cytometry: Antibody-based flow cytometry can assess MT-ND4L in individual cells, allowing for analysis of heterogeneity in mitochondrial content or function across cell populations.

  • Proximity ligation assays: These advanced techniques can detect and visualize interactions between MT-ND4L and other proteins in situ, providing spatial information about protein complexes within intact cells.

When selecting antibodies for MT-ND4L research, researchers should consider species specificity, epitope location, and validation data. For instance, antibodies developed against specific epitopes may be more suitable for certain applications, and verification of specificity is essential for reliable results .

What genetic analysis approaches are used to study MT-ND4L variants in disease association studies?

Researchers employ several sophisticated genetic analysis approaches to investigate MT-ND4L variants in disease association studies:

  • Whole exome sequencing (WES): Specialized pipelines have been developed for accurate assembly and variant calling in mitochondrial genomes embedded within WES data, as demonstrated in the Alzheimer's Disease Sequencing Project that analyzed 10,831 participants .

  • Single variant association testing: The SCORE test has been used to evaluate the association between individual MT-ND4L variants and disease risk, successfully identifying significant associations such as that between the rs28709356 C>T variant and Alzheimer's disease (P = 7.3 × 10−5) .

  • Gene-based testing: Methods like SKAT-O allow for assessment of the cumulative effect of multiple variants within MT-ND4L on disease risk, providing additional statistical power when individual variants are rare .

  • Haplogroup analysis: Mitochondrial haplogroup determination helps contextualize MT-ND4L variants within evolutionary lineages, potentially revealing population-specific disease associations.

  • Sanger sequencing: This targeted approach has been used to sequence MT-ND4L in specific cohorts, such as the 68 subfertile and 44 fertile males examined for associations between MT-ND4L polymorphisms and infertility .

These genetic approaches, often used in combination, provide complementary information about the prevalence, functional impact, and disease associations of MT-ND4L variants.

How can researchers measure MT-ND4L expression and activity in cellular and tissue samples?

Researchers employ multiple complementary approaches to assess MT-ND4L expression and activity:

  • Quantitative PCR (qPCR): This technique measures MT-ND4L transcript levels, providing information about gene expression in different tissues or experimental conditions.

  • Western blotting: Using specific antibodies such as the polyclonal antibody PA5-75197, researchers can quantify MT-ND4L protein levels in tissue or cellular extracts .

  • Complex I activity assays: Spectrophotometric measurement of NADH oxidation in the presence of ubiquinone allows assessment of Complex I activity, which indirectly reflects MT-ND4L function.

  • Oxygen consumption analysis: Respirometry techniques measure oxygen consumption rates in intact cells or isolated mitochondria, providing functional data about the electron transport chain including Complex I.

  • Blue native PAGE: This technique separates intact respiratory complexes, allowing assessment of Complex I assembly and stability, which may be affected by MT-ND4L mutations.

  • Mitochondrial membrane potential measurement: Fluorescent dyes sensitive to membrane potential provide information about the proton gradient generated by the electron transport chain, indirectly reflecting MT-ND4L function as part of Complex I.

By combining these approaches, researchers can develop a comprehensive understanding of MT-ND4L expression, incorporation into Complex I, and functional contributions to mitochondrial energy production.

What is known about MT-ND4L mutations in Leber hereditary optic neuropathy (LHON)?

Leber hereditary optic neuropathy (LHON) has been associated with specific mutations in MT-ND4L:

  • T10663C mutation: This mutation, also described as Val65Ala, changes a single amino acid in the NADH dehydrogenase 4L protein, replacing valine with alanine at position 65 . This variant has been identified in several families with LHON.

  • Pathogenic mechanism: While the exact mechanism by which this MT-ND4L mutation leads to LHON remains incompletely understood, it likely disrupts Complex I function, affecting energy production particularly in retinal ganglion cells and the optic nerve .

  • Clinical presentation: LHON typically manifests as rapid, painless loss of central vision, predominantly affecting young adult males. The MT-ND4L mutation contributes to this rare condition that can cause significant visual impairment .

  • Tissue specificity: An intriguing aspect of LHON is that despite the mutation being present in all mitochondria throughout the body, the disease primarily affects the optic nerve. This tissue specificity suggests that additional factors beyond the mutation itself contribute to the pathogenesis.

Understanding these mutations provides insights into both the specific role of MT-ND4L in Complex I function and the broader mechanisms of mitochondrial disease expression.

How does the association between MT-ND4L variants and Alzheimer's disease compare with other genetic risk factors?

The association between MT-ND4L variants and Alzheimer's disease (AD) represents an important but distinct genetic risk factor compared to established nuclear genome associations:

  • Statistical significance: The rare MT-ND4L variant rs28709356 C>T (minor allele frequency = 0.002) showed study-wide significant association with AD (P = 7.3 × 10−5), as well as gene-based significance (P = 6.71 × 10−5) . This level of significance is comparable to some nuclear gene associations but not as strong as APOE, the strongest known genetic risk factor.

  • Mechanistic distinction: While many nuclear gene variants associated with AD affect amyloid processing, inflammation, or lipid metabolism, MT-ND4L variants likely contribute to disease risk through mitochondrial dysfunction and energy metabolism disruption .

  • Relative contribution: Genome-wide association studies have identified >40 susceptibility loci in the nuclear genome for AD, with MT-ND4L representing one of the few mitochondrial genes with significant disease association .

  • Combined effect: The simultaneous association of both MT-ND4L and the nuclear mitochondrial-related gene TAMM41 with AD suggests a broader role for mitochondrial dysfunction in AD pathogenesis, potentially involving interactions between mitochondrial and nuclear genomes .

This evidence highlights the importance of considering both nuclear and mitochondrial genetic factors in understanding the complex genetic architecture of Alzheimer's disease.

What potential therapeutic approaches might target MT-ND4L dysfunction in mitochondrial diseases?

Several therapeutic strategies could potentially address MT-ND4L dysfunction in mitochondrial diseases:

These approaches remain largely theoretical or experimental for MT-ND4L-specific disorders, and their efficacy would need to be evaluated in appropriate model systems before clinical application.

What are the most promising research avenues for understanding MT-ND4L function and dysfunction?

Several promising research directions could advance our understanding of MT-ND4L:

  • Cryo-electron microscopy studies: High-resolution structural analysis of MT-ND4L within intact Complex I under different functional states could reveal dynamic aspects of its role in electron transport and proton pumping.

  • Single-cell analysis: Examination of MT-ND4L expression and function at the single-cell level could reveal cell-to-cell variability and help explain the tissue specificity of MT-ND4L-related disorders.

  • Mitochondrial-nuclear crosstalk: Investigation of how MT-ND4L dysfunction affects nuclear gene expression, and vice versa, could provide insights into the integrated cellular response to mitochondrial stress.

  • Population genetics: Comprehensive analysis of MT-ND4L variants across human populations could identify additional disease associations and evolutionary patterns of selection.

  • Model systems development: Creation of animal and cellular models with specific MT-ND4L variants would facilitate detailed studies of pathogenic mechanisms and therapeutic testing.

These research directions would benefit from interdisciplinary approaches combining genetics, biochemistry, structural biology, and clinical research to comprehensively understand MT-ND4L's role in health and disease.

What technical advances are needed to better study MT-ND4L and other mitochondrial proteins?

Advancement in MT-ND4L research requires several technical innovations:

  • Improved mitochondrial genome editing: Development of more efficient methods for precise modification of mitochondrial DNA would enable creation of better disease models and functional studies of MT-ND4L variants.

  • Better mitochondrial isolation techniques: Advanced methods for rapid, gentle isolation of functional mitochondria from small tissue samples would facilitate analysis of MT-ND4L in patient-derived materials.

  • Enhanced imaging approaches: Super-resolution and live-cell imaging techniques specific for mitochondrial proteins would improve our understanding of MT-ND4L dynamics and interactions.

  • More sensitive activity assays: Development of highly sensitive methods to measure the specific contribution of MT-ND4L to Complex I function would enable better characterization of variant effects.

  • Improved recombinant expression systems: Better systems for expressing and purifying mitochondrial membrane proteins like MT-ND4L would facilitate structural and functional studies.

These technical advances would collectively enhance our ability to study MT-ND4L and other mitochondrial proteins, accelerating progress in understanding their roles in cellular physiology and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.