Recombinant Ursus americanus Gap junction alpha-1 protein (GJA1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Ursus americanus GJA1 is typically expressed in heterologous systems such as:

  • Escherichia coli: For high-yield production of non-glycosylated protein .

  • Mammalian Cells (HEK293): For post-translational modifications (e.g., phosphorylation) .

  • Baculovirus-Insect Systems: For large-scale functional studies .

Purification Workflow

StepMethodOutcome
Affinity ChromatographyNi-NTA (His-tag)>85% purity
Buffer ExchangeTris/PBS with 6% TrehaloseStabilization for storage
LyophilizationFreeze-dryingLong-term stability

Biological Roles

  • Cardiac Function: Regulates synchronized cardiomyocyte contractions via gap junction-mediated electrical coupling .

  • Ciliogenesis: Interacts with Rab11/Rab8 trafficking pathways to modulate ciliary assembly .

  • Metabolic Regulation:

    • Promotes mitochondrial biogenesis and reduces ROS production under ischemic stress .

    • Modulates adipocyte hypertrophy and insulin sensitivity .

Key Pathways Involving GJA1

PathwayAssociated Proteins
Arrhythmogenic Right Ventricular CardiomyopathyITGB4, CACNA2D3, ACTN2
Gap Junction AssemblyGJC2, GJA8, PANX2
Mitochondrial BiogenesisNOV, Rab11, BBS4

Experimental Models

  • In Vitro Studies: Used in human RPE1 cells to investigate primary ciliogenesis defects .

  • Animal Models:

    • Xenopus laevis embryos for motile cilia analysis .

    • Mus musculus models of cardiac ischemia/reperfusion injury .

Therapeutic Potential

  • Cardioprotection: AAV9-mediated GJA1-20k delivery reduces myocardial infarct size by 40% in mice .

  • Metabolic Disorders: Conditional Gja1 ablation in mice improves glucose tolerance and reduces diet-induced obesity .

Limitations

  • Species-specific functional divergences may limit extrapolation to human physiology .

  • Post-translational modifications (e.g., phosphorylation) vary by expression system .

Emerging Research Areas

  • Structural Biology: Cryo-EM studies to resolve channel gating mechanisms .

  • Gene Therapy: Optimizing delivery vectors for GJA1 isoforms in cardiac and metabolic diseases .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, kindly indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your reconstitution.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-382
Protein Length
Full Length of Mature Protein
Species
Ursus americanus (American black bear) (Euarctos americanus)
Target Names
Target Protein Sequence
GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLATGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function
Gap junction protein that acts as a regulator of bladder capacity. A gap junction comprises a cluster of closely packed pairs of transmembrane channels, known as connexons, facilitating the diffusion of low molecular weight materials between neighboring cells. This protein may play a crucial role in auditory physiology by participating in the recycling of potassium to the cochlear endolymph. It acts as a negative regulator of bladder functional capacity by enhancing intercellular electrical and chemical transmission, thereby sensitizing bladder muscles to cholinergic neural stimuli, leading to their contraction. This protein may also be involved in cell growth inhibition through the regulation of NOV expression and localization. Furthermore, it plays an essential role in gap junction communication within the ventricles.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.

Q&A

What is the molecular structure of GJA1 and how does it function in cell-to-cell communication?

GJA1 (Connexin43) consists of four transmembrane domains (TM1-4), two extracellular loops, one intracellular loop, and cytoplasmic N-terminal and C-terminal domains. The protein forms hexameric structures called connexons or hemichannels that dock with counterparts on adjacent cells to form gap junction channels.

The three-dimensional structure of GJA1 gap junction channels has been determined by electron crystallography at resolutions of 7.5 angstroms in the membrane plane and 21 angstroms in the vertical direction. The channel forms a dodecameric structure through the end-to-end docking of two hexamers. Each hexamer displays 24 rods of density in the membrane interior, consistent with an alpha-helical conformation for the four transmembrane domains of each connexin subunit .

For functional analysis, researchers should note that GJA1 forms channels that allow the transport of:

  • Small molecules (<1 kDa)

  • Ions

  • Second messengers

  • Metabolites

The extracellular vestibule formed by the extracellular domains provides a tight seal that prevents exchange with the extracellular environment, ensuring direct cytoplasmic communication between adjacent cells .

What expression systems are most effective for producing recombinant Ursus americanus GJA1?

Successful expression of recombinant Ursus americanus GJA1 has been achieved using several systems with varying advantages:

Expression SystemAdvantagesLimitationsPost-translational Modifications
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications, potential inclusion body formationMinimal
Mammalian cells (HEK293)Native-like folding and modifications, functional testing possibleLower yields, more expensive, longer production timeComplete range similar to native protein
Insect cellsHigher yields than mammalian cells, some post-translational modificationsGlycosylation patterns differ from mammalian systemsIntermediate complexity
YeastModerate yield, eukaryotic processingHyper-glycosylation may occurPartial, glycosylation patterns differ

For functional studies requiring proper membrane insertion and trafficking, mammalian expression systems are recommended as they better recapitulate the native cellular environment. For structural studies requiring larger protein quantities, insect cell systems offer a compromise between yield and proper folding .

How can researchers verify the proper folding and functionality of recombinant GJA1?

Verification of proper GJA1 folding and functionality requires multi-parameter assessment:

  • Structural verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate domain folding

    • Size-exclusion chromatography to confirm oligomeric state

  • Functional assessment:

    • Dye transfer assays using Lucifer Yellow microinjection to confirm gap junction channel function

    • Electrophysiological measurements to evaluate channel conductance

    • Hemichannel activity assessment using ATP release assays

  • Localization studies:

    • Immunofluorescence to verify membrane localization and gap junction plaque formation

    • Proximity ligation assays to confirm interactions with known binding partners

When evaluating gap junction-mediated intercellular communication (GJIC), researchers can quantify dye coupling by counting intercellular transfer of Lucifer Yellow microinjected into cells. Functional GJA1 will demonstrate effective dye-coupling when cells are appropriately activated, as observed in bone marrow-derived dendritic cells (BMDCs) stimulated with LPS plus IFN-γ or TNF-α plus IFN-γ .

What are the key regulatory mechanisms affecting GJA1 function that researchers should consider?

GJA1 function is regulated through multiple mechanisms that should be considered in experimental design:

Post-translational modifications:

  • Phosphorylation sites on the C-terminal domain regulate channel opening/closing, protein trafficking, and degradation

  • Ubiquitination targets the protein for degradation

  • S-nitrosylation affects channel permeability

Protein-protein interactions:

  • ZO-1 interaction with the C-terminus regulates GJA1 stability and localization

  • Interaction with tubulin affects GJA1 trafficking

  • Rab8a and Rab11a proteins interact with GJA1 and influence its cellular distribution

Regulatory pathways:

  • MAPK pathway components affect GJA1 phosphorylation state

  • ACTR2/ARP2-ACTR3/ARP3-dependent actin remodeling influences GJA1-mediated exocytosis of damaged lysosomes

Researchers should be aware that these regulatory mechanisms may differ across species and cell types, necessitating validation in the specific experimental context.

What specialized techniques are recommended for studying the interaction between GJA1 and other cellular components?

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationPhysical interaction identificationIdentifies native protein complexesMay miss transient interactions
Proximity ligation assayIn situ protein interaction detectionSingle-molecule sensitivity, spatial informationRequires highly specific antibodies
FRET/BRETReal-time interaction dynamicsLive cell analysis, temporal resolutionComplex setup, potential artifacts
Immunofluorescence co-localizationSpatial relationship analysisPreserves cellular architectureNot definitive proof of interaction
IP-MSComprehensive interactome mappingUnbiased, high-throughputPotential for false positives
Structured illumination microscopy (SIM)High-resolution localizationSuperior resolution for membrane structuresTechnically demanding, potential artifacts

For example, when studying GJA1 interaction with Rab11a, researchers successfully employed co-immunoprecipitation followed by western blot, confirming that GJA1 can be immunoprecipitated with Rab11a . Structured illumination microscopy further revealed that Rab11-positive vesicles encircle the base of ciliary axoneme, and this pattern is disrupted upon GJA1 depletion .

How can researchers effectively distinguish between full-length GJA1 and its truncated isoforms in experimental systems?

Distinguishing between full-length GJA1 (GJA1-43k) and its truncated isoforms, particularly GJA1-20k, requires careful experimental design:

Antibody selection strategies:

  • Use antibodies targeting the N-terminal region to specifically detect full-length GJA1

  • Use C-terminal antibodies to detect both full-length and truncated isoforms

  • Develop isoform-specific antibodies targeting junction regions unique to each isoform

Molecular biology approaches:

  • Employ site-directed mutagenesis of alternative translation start sites (e.g., M213L mutation eliminates GJA1-20k expression while preserving full-length protein)

  • Design PCR primers that specifically amplify regions unique to each isoform

  • Use epitope tagging at N-terminal and C-terminal regions to distinguish isoforms

Analytical separation:

  • Perform western blotting with gradient gels to resolve the different molecular weight isoforms

  • Use 2D gel electrophoresis to separate isoforms with different post-translational modifications

Researchers should be aware that conventional C-terminal antibodies will detect both full-length GJA1 and C-terminal fragments, potentially leading to misinterpretation of results. As noted in the literature, "antibodies specific for the detection of GJA1-20k will also react with full-length Cx43, making it difficult to differentiate between the two in patient biopsies" .

What methodological approaches are recommended for investigating GJA1's role in lysosomal trafficking and autophagy?

Recent research has revealed that GJA1 promotes the exocytosis of damaged lysosomes through mechanisms dependent on actin remodeling . To investigate this non-canonical function:

Recommended experimental approaches:

  • Lysosomal damage induction and tracking:

    • Use lysosomotropic agents (chloroquine, LLOMe) to induce lysosomal damage

    • Track damaged lysosomes with galectin-3 puncta formation

    • Employ pH-sensitive lysosomal dyes (LysoTracker) to monitor lysosomal integrity

  • Exocytosis assessment:

    • Measure secreted lysosomal enzyme activity (β-hexosaminidase, cathepsins)

    • Use TIRF microscopy to visualize lysosomal fusion events

    • Employ cell surface biotinylation to detect lysosomal membrane proteins externalized during exocytosis

  • GJA1 functional manipulation:

    • CRISPR/Cas9-mediated gene editing to create defined GJA1 mutations

    • Expression of dominant-negative GJA1 mutants (T154A, Δ130-136, Δ234-243)

    • siRNA-mediated knockdown with rescue experiments using non-targetable constructs

  • Actin dynamics visualization:

    • Live-cell imaging with LifeAct or SiR-Actin

    • Co-immunoprecipitation studies to detect GJA1 interaction with ACTR2/ARP2-ACTR3/ARP3 complex

    • Inhibition of actin remodeling with cytochalasin D to confirm pathway dependence

Research has shown that GJA1 promotes the exocytosis of damaged lysosomes through a mechanism relying on ACTR2/ARP2-ACTR3/ARP3-dependent actin remodeling, contributing to the release of dysfunctional lysosomes during pathogen infection and lysosomal storage disorders .

How does the GJA1-20k isoform influence cellular processes, and what techniques are recommended for studying its specific functions?

GJA1-20k, generated through alternative translation initiation at M213, has emerged as a functionally important isoform with distinct roles:

Functional roles of GJA1-20k:

  • Facilitates trafficking of full-length GJA1-43k to plasma membrane

  • Regulates mitochondrial fission and distribution

  • Influences cytoskeletal dynamics

  • Protects against cytosolic redistribution of Cx43 during epithelial-mesenchymal transition (EMT)

Recommended techniques for functional studies:

  • Alternative translation manipulation:

    • Site-directed mutagenesis of the M213 start site to selectively eliminate GJA1-20k expression

    • IRES activity modulation to alter the ratio of full-length to truncated isoforms

    • Design of constructs expressing only GJA1-20k for rescue experiments

  • Mitochondrial dynamics assessment:

    • Live-cell imaging of mitochondrial fission/fusion using MitoTracker

    • Analysis of mitochondrial distribution using structured illumination microscopy

    • Measurement of mitochondrial membrane potential in GJA1-20k-deficient cells

  • Trafficking studies:

    • Pulse-chase labeling to track GJA1-43k trafficking in the presence/absence of GJA1-20k

    • FRAP (Fluorescence Recovery After Photobleaching) to measure gap junction dynamics

    • Triton X-100 solubility assay to fractionate and quantify junctional versus non-junctional GJA1

Research has demonstrated that GJA1-20k expression is suppressed during TGF-β-induced epithelial-mesenchymal transition, stabilizing full-length Connexin43 in the Golgi, reducing channel oligomerization, cell surface expression, and gap junction formation . The physiological importance of GJA1-20k is highlighted by the observation that mice homozygous for the M213L mutation (eliminating GJA1-20k) die suddenly around 2-4 weeks of age, with median lifespan of 18 days .

What are the methodological considerations for investigating GJA1's role in ciliogenesis?

Recent research has revealed an unexpected role for GJA1 in cilia formation . To investigate this function:

Recommended experimental design:

  • Cilia induction and visualization:

    • Serum starvation protocols for primary cilia induction

    • Immunofluorescence using acetylated tubulin antibodies to visualize ciliary axonemes

    • Scanning electron microscopy for detailed ciliary structure analysis

  • GJA1 manipulation approaches:

    • siRNA-mediated knockdown with rescue experiments using non-targetable constructs

    • Expression of dominant-negative mutants (T154A, Δ130-136, Δ234-243)

    • CRISPR/Cas9-mediated F0 mutagenesis in model organisms like Xenopus

  • Protein interaction studies:

    • Co-immunoprecipitation of GJA1 with Rab8a and Rab11a

    • Structured illumination microscopy to visualize Rab11-positive vesicles at ciliary base

    • Analysis of Rab protein levels and localization in GJA1-depleted cells

Experimental controls and validations:

  • Cell fate markers (e.g., DNAH9) to distinguish between effects on cell specification versus ciliogenesis

  • Rescue experiments with wild-type versus mutant GJA1 constructs

  • Assessment of ciliary length in isolated cilia from control versus experimental conditions

Studies have shown that GJA1 depletion in human RPE1 cells significantly disrupts cilia formation, and this defect can be partially rescued by co-transfection with siRNA-non-targetable GJA1 cDNA. GJA1 localizes to the pericentriolar region and interacts with Rab11a, with this interaction disrupted in dominant-negative GJA1 mutants .

What experimental approaches are recommended for investigating GJA1's role in neurodegenerative diseases like Alzheimer's?

GJA1 has been identified as a key regulator of an astrocyte-enriched gene network associated with Alzheimer's disease (AD) . To explore this function:

Recommended methodological approaches:

  • Network-based analyses:

    • Construction of GJA1-centric consensus co-expression networks from multiple brain region datasets

    • Identification of genes significantly correlated with GJA1 using BH-corrected p-values

    • Development of GJA1 signaling maps through Bayesian network analysis

  • Functional validation in model systems:

    • Astrocyte-specific Gja1 knockout models

    • RNA-seq analysis of wild-type versus Gja1-/- astrocytes

    • Projection of in vitro gene signatures onto GJA1-centric networks

  • Molecular and cellular phenotyping:

    • Analysis of AD pathological traits in relation to GJA1 expression

    • Assessment of astrocyte reactivity markers

    • Evaluation of neuroinflammatory responses

  • Therapeutic exploration:

    • Modulation of GJA1 expression or function in AD models

    • Targeting specific interactions within the GJA1-regulated network

    • Assessment of effects on AD-related endpoints (amyloid, tau, neurodegeneration)

Research has demonstrated that GJA1 is a key regulator of an astrocyte-specific gene subnetwork dysregulated in Late-Onset Alzheimer's Disease (LOAD). GJA1-centered correlation networks have been constructed across multiple brain regions to identify consensus GJA1-centered correlation signatures (CGCCS), revealing its central role in disease pathology .

How can researchers effectively study the immune regulatory functions of GJA1?

GJA1 has been implicated in immune regulation, particularly in dendritic cell (DC) function and tumor immunity . To investigate these roles:

Recommended approaches for immunological studies:

  • Gap junction-mediated intercellular communication (GJIC) assessment:

    • Dye transfer assays using Lucifer Yellow microinjection

    • Fluorescence recovery after photobleaching (FRAP)

    • Dual patch-clamp techniques to measure electrical coupling

  • Immune cell activation studies:

    • Analysis of costimulatory molecule expression (CD40, CD80, CD86)

    • Measurement of MHC class II expression

    • Evaluation of allostimulatory capacity in mixed lymphocyte reactions

  • Mechanism dissection:

    • Gap junction blockers (heptanol, Cx mimetic peptides) to determine GJIC-dependent effects

    • Analysis of cytokine production (particularly TNF-α) in response to TLR stimulation

    • Assessment of cell-to-cell contact requirements for immune activation

  • Tumor immunity correlation:

    • Analysis of immune infiltrates in relation to GJA1 expression using TIMER database

    • Correlation of GJA1 expression with gene markers of tumor-infiltrating immune cells

    • Evaluation of tumor purity and abundance of immune infiltrates

Research has shown that dendritic cells form gap junction-mediated intercellular communication when activated with LPS plus IFN-γ or TNF-α plus IFN-γ. This GJIC is required for effective DC activation, as evidenced by the inhibition of costimulatory molecule expression and reduced allostimulatory capacity when gap junctions are blocked . In tumor contexts, GJA1 expression correlates with immune infiltration patterns, suggesting a role in regulating the tumor immune microenvironment .

What are the current technical challenges in studying GJA1 mutations and their pathological consequences?

Studying GJA1 mutations presents several technical challenges that researchers must address:

Challenges and recommended solutions:

  • Distinguishing mutation effects on channel versus non-channel functions:

    • Develop assays that specifically measure gap junction-dependent and -independent functions

    • Use combinatorial approaches with channel-dead mutants plus specific domain deletions

    • Employ domain-specific rescue experiments to identify critical functional regions

  • Heteromeric connexon complexity:

    • Design strategies to control connexin stoichiometry in expression systems

    • Use single-molecule imaging techniques to determine subunit composition

    • Develop computational models to predict heteromeric channel properties

  • Tissue-specific effects of mutations:

    • Generate tissue-specific conditional knockin models

    • Develop iPSC-derived organoid systems from patient samples

    • Perform comparative analyses across multiple cell types from the same genetic background

  • Interpreting clinical variants:

    • Systematic functional characterization of disease-associated variants

    • Development of high-throughput screening platforms for variant classification

    • Integration of structural modeling with functional data

A specific example from the literature is the R239Q mutation in GJA1, which causes autosomal recessive craniometaphyseal dysplasia. This mutation changes a single amino acid (arginine replaced with glutamine at position 239) in the connexin 43 protein. The challenge remains in determining exactly how this mutation leads to the bone abnormalities seen in affected individuals .

What advanced imaging techniques are most valuable for studying GJA1 trafficking and dynamics?

Understanding GJA1 trafficking and dynamics requires advanced imaging approaches:

Imaging TechniqueApplicationKey AdvantagesTechnical Considerations
FRAP (Fluorescence Recovery After Photobleaching)Gap junction plaque dynamicsMeasures mobile fraction and diffusion rateRequires careful ROI selection and bleaching parameters
STED (Stimulated Emission Depletion) microscopyNanoscale organization of GJA1Resolution below diffraction limit (~30-80nm)Requires specific fluorophores, potential phototoxicity
SIM (Structured Illumination Microscopy)Vesicular trafficking visualization2x resolution improvement, compatible with live imagingComplex reconstruction algorithms, potential artifacts
Single-particle trackingGJA1 hemichannel mobilityReal-time dynamics at single-molecule levelRequires sparse labeling, sophisticated analysis
TIRF (Total Internal Reflection Fluorescence)Membrane insertion eventsExcellent signal-to-noise for near-membrane eventsLimited to ~100nm from coverslip
FCS (Fluorescence Correlation Spectroscopy)Protein diffusion and clusteringQuantitative measurement of molecular dynamicsComplex setup and analysis
PALM/STORMNanoscale distribution of GJA1Single-molecule localization precision (~20nm)Requires photoswitchable fluorophores, long acquisition times

Research has employed structured illumination microscopy (SIM) to visualize the relationship between GJA1 and Rab11-positive vesicles at the base of primary cilia. SIM analysis revealed that Rab11-positive vesicles encircle the base of the ciliary axoneme, a pattern disrupted upon GJA1 depletion .

How can researchers investigate the molecular mechanisms of GJA1-mediated mitochondrial regulation?

GJA1, particularly the GJA1-20k isoform, has been implicated in mitochondrial dynamics and function . To investigate this role:

Recommended experimental approaches:

  • Mitochondrial morphology and dynamics assessment:

    • Live-cell imaging with mitochondrial markers (MitoTracker, mito-GFP)

    • Quantification of fission/fusion events using photoactivatable mitochondrial markers

    • Measurement of mitochondrial network parameters (length, branching, connectivity)

  • Mitochondrial function evaluation:

    • Oxygen consumption rate (OCR) measurement using Seahorse analyzer

    • Membrane potential assessment with JC-1 or TMRM dyes

    • ROS production quantification using specific fluorescent probes

  • Mitochondrial distribution analysis:

    • High-resolution imaging of mitochondrial positioning relative to cellular structures

    • Live-cell tracking of mitochondrial movement in response to stimuli

    • Quantification of perinuclear versus peripheral mitochondrial distribution

  • Interaction with mitochondrial machinery:

    • Co-immunoprecipitation of GJA1 with mitochondrial fission/fusion proteins

    • Proximity ligation assays to detect interactions in situ

    • Analysis of mitochondrial protein import in GJA1-manipulated cells

In cancer research, GJA1-20k has been shown to modulate mitochondrial activity and dynamics under stressful conditions. Multiple studies have demonstrated that increased mitochondrial fission promotes cancer progression, particularly cell migration and invasion. Given GJA1-20k's role in inducing mitochondrial fission and redistribution, it may play an important role in tumor plasticity, cancer cell metastasis, survival, and quiescence in secondary sites such as hypoxic bone .

What are the most effective approaches for studying GJA1 in disease models?

Investigating GJA1 in disease contexts requires tailored approaches depending on the condition:

Recommended disease modeling strategies:

  • Genetic models:

    • CRISPR/Cas9-engineered point mutations (e.g., R239Q for craniometaphyseal dysplasia)

    • Conditional knockout/knockin models for tissue-specific analysis

    • Alternative translation blockade (M213L) to eliminate GJA1-20k while preserving full-length protein

  • Cellular models:

    • iPSC-derived disease-relevant cell types

    • 3D organoid cultures to recapitulate tissue architecture

    • Co-culture systems to study cell-cell interactions

  • Functional readouts:

    • Disease-specific phenotypic assays (e.g., bone remodeling for skeletal disorders)

    • Gap junctional communication assessment in context

    • Molecular pathway analysis with phospho-specific antibodies

  • Therapeutic exploration:

    • Small molecule modulators of GJA1 function or trafficking

    • Viral delivery of GJA1 or GJA1-20k for rescue experiments

    • Targeted protein degradation approaches

For cardiac conditions, mouse models with the M213L mutation (eliminating GJA1-20k) have proven valuable. These models demonstrate that young M213L/M213L mice (lacking GJA1-20k) show greatly reduced R wave amplitude and tripled QRS complex duration, highlighting the critical role of GJA1-20k in cardiac function . For Alzheimer's disease research, construction of GJA1-centric consensus co-expression networks from multiple brain region datasets has revealed its role as a key driver of astrocyte-enriched subnetworks associated with disease pathology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.