Recombinant Ursus arctos NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression Systems

  • Host: Typically produced in E. coli or mammalian cell systems for high-yield expression .

  • Tag: Often fused with a polyhistidine (His) tag for affinity chromatography purification .

Key Production Parameters

ParameterDetails
Purity>85% (verified by SDS-PAGE)
FormLyophilized powder or liquid in Tris-based buffer with 50% glycerol
ReconstitutionResuspend in deionized water (0.1–1.0 mg/mL); add glycerol for storage
Storage-20°C/-80°C (lyophilized: 12 months; liquid: 6 months)

Biochemical Function

Role in Mitochondrial Complex I

  • Catalyzes electron transfer from NADH to ubiquinone, initiating the proton-pumping mechanism .

  • Forms part of the hydrophobic core of Complex I’s transmembrane domain, essential for maintaining structural integrity .

Key Functional Residues

  • Valine 65 (V65): Mutation to alanine disrupts proton translocation, linked to mitochondrial diseases like Leber’s Hereditary Optic Neuropathy (LHON) in humans .

Research Applications

Primary Uses

  • Structural Studies: Investigating the molecular architecture of Complex I in Ursidae species .

  • Functional Assays: Testing proton translocation efficiency and electron transfer kinetics .

  • Comparative Biology: Studying evolutionary conservation of mitochondrial proteins across mammals .

Critical Considerations

  • Freeze-Thaw Cycles: Repeated cycles degrade protein integrity; aliquot for single-use .

  • Buffers: Tris/PBS-based formulations with trehalose or glycerol enhance stability .

Comparative Analysis with Other Species

FeatureUrsus arctos Homo sapiens Felis catus
Amino Acid Length989898
Key ResiduesV65, T66V65, T66V65, T66
UniProt IDQ8SJH9P03901P48931

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Ursus arctos (Brown bear) (Grizzly bear)
Target Names
Target Protein Sequence
MPVVYVNIFLAFIVSLMGLLVYRSHLMSSLLCLEGMMLSLFVMLTVTVLNNHFTLANMAP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary structure and function of Ursus arctos MT-ND4L?

MT-ND4L is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor . In Ursus arctos (brown bear), MT-ND4L is encoded by the mitochondrial genome. The protein is embedded in the lipid bilayer as part of the enzyme membrane arm and is critically involved in proton translocation .

The primary sequence of MT-ND4L is relatively short, consisting of approximately 98 amino acids, similar to the protein in other mammalian species . The protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane, with its hydrophobic nature reflecting its membrane-embedded function .

How does MT-ND4L contribute to electron transport in mitochondria?

MT-ND4L functions as an integral component of Complex I, which is responsible for the first step in the electron transport process during oxidative phosphorylation. Specifically, it participates in the transfer of electrons from NADH to ubiquinone .

During this process:

  • NADH donates electrons to Complex I

  • The electrons are transferred through a series of iron-sulfur clusters

  • MT-ND4L contributes to the proton pumping mechanism that creates an electrochemical gradient across the inner mitochondrial membrane

  • This gradient subsequently drives ATP synthesis by ATP synthase

This proton translocation function is critical, as Complex I contributes significantly to the proton motive force that powers ATP production . The efficiency of this process in Ursus arctos may reflect evolutionary adaptations to the bear's energy requirements and hibernation cycles.

What is the conservation status of MT-ND4L across ursid species?

Mitochondrial genome analyses have revealed interesting patterns of conservation for MT-ND4L across bear species. In phylogenetic studies, MT-ND4L sequences have been used alongside other mitochondrial genes to reconstruct evolutionary relationships within Ursidae .

The table below shows mitochondrial genome characteristics across selected bear species, including information relevant to MT-ND4L:

SpeciesGenome Length (bp)G+C nucleotide content (%)
U. arctos17,02040.8
U. maritimus17,01740.8
U. thibetanus16,79540.7
U. americanus16,84140.4
U. malayanus16,78340.7
U. ursinus16,81741.6
Tremarctos ornatus16,76641.1

While MT-ND4L is among the shorter mitochondrial genes (around 300 bp), sequence analyses indicate that it shows lower variability within species compared to between species, making it valuable for phylogenetic studies .

What expression systems are optimal for producing recombinant Ursus arctos MT-ND4L?

Due to the hydrophobic nature and membrane integration requirements of MT-ND4L, expression systems must be carefully selected. Based on similar mitochondrial membrane proteins, the following approaches are recommended:

  • Bacterial expression systems: While E. coli systems offer high yield, the hydrophobic nature of MT-ND4L often leads to inclusion body formation. Modified strains like C41(DE3) or C43(DE3) that are adapted for membrane protein expression can improve solubility.

  • Yeast expression systems: Pichia pastoris provides a eukaryotic environment and can properly fold membrane proteins with post-translational modifications.

  • Mammalian cell lines: HEK293 or CHO cells offer superior folding and post-translational modifications for mammalian mitochondrial proteins, though with lower yields.

  • Cell-free systems: These can be supplemented with lipids or detergents to facilitate proper folding of membrane proteins like MT-ND4L.

Expression should be optimized with fusion tags that enhance solubility and enable purification while minimizing interference with protein function and structure. A systematic comparison of different expression conditions is essential for functional studies .

What purification strategies are effective for recombinant MT-ND4L?

Purifying recombinant MT-ND4L presents significant challenges due to its hydrophobic properties and membrane integration. Effective purification strategies include:

  • Detergent solubilization: Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin can extract MT-ND4L from membranes while preserving native conformation.

  • Affinity chromatography: His-tags or other affinity tags facilitate purification, though placement should be optimized to prevent interference with protein function.

  • Size exclusion chromatography: Essential for separating monomeric protein from aggregates and removing detergent micelles.

  • Ion exchange chromatography: Can be used as an additional purification step, though buffer conditions must be carefully optimized.

  • Lipid reconstitution: Following purification, reconstitution into liposomes or nanodiscs can provide a native-like environment for functional studies.

Quality assessment should include SDS-PAGE, western blotting, and mass spectrometry to confirm protein identity and purity, along with functional assays to verify that the recombinant protein retains native activity .

How can the function of recombinant Ursus arctos MT-ND4L be assayed in vitro?

Assessing the function of recombinant MT-ND4L requires techniques that can measure its contribution to Complex I activity. Recommended approaches include:

  • NADH:ubiquinone oxidoreductase activity assays: Spectrophotometric measurement of NADH oxidation using artificial electron acceptors like ubiquinone analogs.

  • Proton translocation measurements: Techniques such as pH-sensitive dyes or proton flux measurements can detect proton pumping activity.

  • Reconstitution studies: Incorporating recombinant MT-ND4L into proteoliposomes with other Complex I components to assess restoration of electron transport.

  • Membrane potential measurements: Fluorescent probes can detect changes in membrane potential related to MT-ND4L activity.

  • Oxygen consumption measurements: Using oxygen electrodes to measure respiratory rates in reconstituted systems.

These functional assays should be complemented with structural studies to correlate activity with protein conformation and interaction with other Complex I components .

What site-directed mutagenesis approaches are most informative for studying MT-ND4L function?

Site-directed mutagenesis offers valuable insights into structure-function relationships of MT-ND4L. Based on current understanding of Complex I components, these approaches should focus on:

  • Conserved residues: Targeting amino acids that are highly conserved across species, particularly those in transmembrane domains.

  • Disease-associated mutations: Introducing mutations analogous to those found in human MT-ND4L associated with Leber hereditary optic neuropathy, such as the T10663C (Val65Ala) mutation .

  • Proton channel residues: Mutating residues predicted to participate in proton translocation pathways.

  • Protein-protein interaction sites: Modifying residues at interfaces with other Complex I subunits.

  • Evolutionary divergent sites: Targeting residues that differ between Ursus arctos and other bear species to understand evolutionary adaptations.

Each mutant should be characterized for expression, stability, membrane integration, and functional activity compared to wild-type protein. Comparative analysis across multiple mutations can reveal critical functional domains .

How has MT-ND4L contributed to understanding ursid phylogeny?

MT-ND4L, as part of the mitochondrial genome, has been instrumental in resolving phylogenetic relationships within Ursidae. Studies utilizing complete mitochondrial genomes, including MT-ND4L, have provided several key insights:

  • The mitochondrial genome-based phylogeny of Ursidae has resolved taxonomic relationships with strong statistical support (70-100% bootstrap support and 0.85-1.00 posterior probability) .

  • Analysis of genetic diversity within MT-ND4L and other mitochondrial genes has helped estimate divergence times between bear species, with the basal split of crown Ursinae (genus Ursus) estimated at approximately 6.3±0.8 Ma .

  • MT-ND4L sequences have contributed to understanding the coalescent times between different populations of Asian black bears (Ursus thibetanus), with the Japanese and continental populations estimated to have diverged 1.48±0.67 Ma .

  • Comparative analysis of MT-ND4L across bear species has revealed patterns of selection and conservation that reflect functional constraints on this protein .

This molecular evidence has complemented fossil records and provided a robust framework for understanding bear evolution and speciation events .

What do comparative analyses of MT-ND4L sequences reveal about functional constraints across species?

Comparative analyses of MT-ND4L sequences across species provide insights into functional constraints on this protein:

  • Conservation patterns: Studies across bear species show that MT-ND4L exhibits lower nucleotide diversity within species compared to between species, suggesting functional constraints maintain sequence conservation .

  • Selection pressure: The ratio of non-synonymous to synonymous substitutions in MT-ND4L across ursid species indicates purifying selection, reflecting the protein's essential role in energy metabolism .

  • Variable regions: Certain regions of MT-ND4L show higher variability than others, potentially identifying functionally less constrained domains .

  • Substitution rates: Analysis across bear species indicates that MT-ND4L and other mitochondrial genes show time-dependent evolutionary rates, with higher rates observed in short-term (<1-2 Myr) compared to long-term (>1-2 Myr) evolutionary periods .

These patterns of conservation and variation provide insight into the structural and functional constraints on MT-ND4L across evolutionary time, potentially identifying regions critical for function versus those permissive to change .

How can recombinant Ursus arctos MT-ND4L serve as a model for human mitochondrial diseases?

Recombinant Ursus arctos MT-ND4L can provide valuable insights into human mitochondrial diseases, particularly those involving Complex I dysfunction:

  • Conservation of function: The functional domains of MT-ND4L are highly conserved between bears and humans, making Ursus arctos MT-ND4L a relevant model for understanding human mitochondrial diseases .

  • Disease-associated mutations: Specific mutations in human MT-ND4L are associated with conditions like Leber hereditary optic neuropathy. The T10663C (Val65Ala) mutation can be studied in the bear ortholog to understand pathogenic mechanisms .

  • Comparative analysis: Differences between human and bear MT-ND4L may reveal insights into species-specific adaptations that could inform therapeutic strategies for human diseases.

  • Functional reconstitution: Recombinant bear MT-ND4L can be used in reconstitution studies to assess how mutations affect Complex I assembly and function, providing a model system for testing potential therapeutic approaches .

  • Oxidative stress models: Since mitochondrial DNA damage is linked to conditions like atherosclerosis, recombinant MT-ND4L can be used to study how Complex I dysfunction contributes to oxidative stress and disease pathogenesis .

By studying the effects of mutations in a controlled system using recombinant protein, researchers can better understand the molecular mechanisms underlying mitochondrial diseases and potentially identify novel therapeutic targets .

What experimental approaches can detect MT-ND4L dysfunction in mitochondrial disease models?

Several experimental approaches can effectively detect MT-ND4L dysfunction in mitochondrial disease models:

  • PCR-based mtDNA damage assessment: Semi-quantitative PCR can identify mtDNA adducts and deletions affecting the MT-ND4L gene, as described for detecting the mouse equivalent of the human common 4977-bp deletion .

  • Respiratory chain complex activity assays: Spectrophotometric assays measuring NADH:ubiquinone oxidoreductase activity can quantify Complex I function in isolated mitochondria or tissue samples .

  • Oxygen consumption measurements: High-resolution respirometry can assess the impact of MT-ND4L dysfunction on cellular bioenergetics.

  • Metabolomic profiling: NMR-based metabolomic analysis of plasma and tissue extracts can identify metabolic signatures associated with MT-ND4L dysfunction, similar to approaches used in analyzing mitochondrial dysfunction in disease models .

  • Mitochondrial membrane potential assessment: Fluorescent probes can detect changes in membrane potential resulting from impaired proton pumping due to MT-ND4L dysfunction.

  • Reactive oxygen species (ROS) production: Since Complex I dysfunction often leads to increased ROS production, fluorescent indicators can measure oxidative stress resulting from MT-ND4L mutations.

These complementary approaches provide a comprehensive assessment of the functional consequences of MT-ND4L mutations or dysfunction in various experimental systems .

What techniques are most suitable for determining the structure of recombinant MT-ND4L?

Determining the structure of recombinant MT-ND4L presents challenges due to its small size, hydrophobicity, and membrane integration. The following techniques offer complementary approaches:

  • Cryo-electron microscopy (cryo-EM): Most suitable for structural determination of MT-ND4L in the context of the entire Complex I. Recent advances in single-particle cryo-EM have enabled high-resolution structures of membrane protein complexes.

  • X-ray crystallography: While challenging for isolated MT-ND4L, this can be successful when the protein is stabilized with fusion partners or antibody fragments to facilitate crystallization.

  • Nuclear magnetic resonance (NMR) spectroscopy: Solution NMR with detergent-solubilized protein or solid-state NMR can provide detailed structural information about specific regions of MT-ND4L.

  • Molecular dynamics simulations: Computational approaches can predict structural features based on sequence and supplement experimental data, particularly for studying the protein's behavior in a membrane environment .

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify contact points between MT-ND4L and other Complex I subunits.

These approaches are likely to yield the most information when used in combination, with computational modeling integrating data from multiple experimental techniques .

How can protein-protein interactions between MT-ND4L and other Complex I components be characterized?

Characterizing protein-protein interactions between MT-ND4L and other Complex I components requires specialized techniques for membrane proteins:

  • Co-immunoprecipitation with tagged recombinant proteins: Using antibodies against affinity tags on recombinant MT-ND4L to pull down interacting partners.

  • Chemical cross-linking coupled with mass spectrometry: This approach can identify specific amino acid residues involved in interactions between MT-ND4L and other Complex I subunits.

  • Förster resonance energy transfer (FRET): Fluorescently labeled MT-ND4L and potential interaction partners can be analyzed for energy transfer indicating proximity.

  • Surface plasmon resonance (SPR): This technique can quantify binding kinetics between MT-ND4L and other proteins when one component is immobilized on a sensor chip.

  • Yeast two-hybrid membrane protein systems: Modified yeast two-hybrid systems designed for membrane proteins can screen for interactions in a cellular context.

  • Reconstitution studies: Systematic omission or addition of components during Complex I reconstitution can reveal the functional importance of specific interactions.

These methods should be applied with controls to distinguish specific interactions from non-specific associations that can occur with hydrophobic membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.